KEGG   Rattus norvegicus (rat): 252939
Entry
252939            CDS       T01003                                 

Gene name
Gpr37l1
Definition
(RefSeq) G protein-coupled receptor 37-like 1
  KO
K04244  prosaposin receptor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    252939 (Gpr37l1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Prosaposin
    252939 (Gpr37l1)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 252939
NCBI-ProteinID: NP_665727
RGD: 628835
Ensembl: ENSRNOG00000006237
UniProt: B4F7C1
Position
13q13
AA seq 481 aa
MRWLWPLAVSLAVVLAVGPSEVSGAATLSLGGHRAKVQEQQSRPRRGTKDEGPKEVQHYV
PEEWAEYPKPIHPAGLQPTKPLVATSPNPDKDGATSESGQELRTNLTGTPSQRLQIQNPL
YPVTESSYSAYAVMLLALVVFAVGIVGNLSVMCIVWHSYYLKSAWNSILASLALWDFLVL
FFCLPIVIFNEITKQRLLGDVSCRAVPFMEVSSLGVTTFSLCALGIDRFHVATSTLPKVR
PIERCQSILAKLAVIWVGSMMLAVPELLLWQLAQEPTPTMGTVDSCIMKPSADLPESLYS
LVMTYQNARMWWYFGCYFCLPILFTVTCQLVTWRVRGPPGRKPECRAGRHEQCESQLNST
VVGLTVVYAFCTLPENVCNIVVAYLSTELTRQTLDLLGLINQFSTFFKGAITPVLLLCIC
RPLGQAFLDCCCCCCCEECGGASDSSATVSADSKLKAEVSSSIYFHKPRESPPLLPLGTP
C
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgcggtggctgtggcccctggctgtctctcttgctgtcgtgttggctgtggggccgagt
gaggtctctggggctgccaccttatctttgggtggtcatagagccaaggtccaggagcag
cagagtcgaccccgaagaggtaccaaggacgaggggcccaaggaggtacagcactatgta
cctgaggagtgggctgagtaccccaagcccatccaccctgctggcctgcagcccaccaag
cctttggtggccactagccccaacccagacaaggatggggccacctcagagagtggacaa
gagctgaggaccaacctgaccgggacaccaagtcagaggctgcagattcagaaccccctg
tatccggtgaccgagagctcctatagtgcctatgccgtcatgctcctggctctggtggta
tttgctgtgggtatcgtgggcaatctgtctgtcatgtgcattgtgtggcacagctactac
ttgaagagtgcctggaactctatccttgccagcctggctctctgggatttcctggtcctc
ttcttctgcctaccaattgtcatcttcaatgagatcaccaagcagaggctacttggggat
gtttcttgccgagcagtgcccttcatggaggtctcctccctgggagtcacaaccttcagt
ctctgtgccctgggcatagaccgattccatgtggccaccagcaccctgccaaaggtgaga
cccattgagagatgccaatcaatcctggctaaactggctgtcatctgggtgggctccatg
atgctggctgtgcctgaactcctgctgtggcagctggcacaagagcccactcccaccatg
ggaactgtggactcatgtatcatgaaaccttcagctgacctgcccgaatccctctattcg
ctggtgatgacctaccagaatgcccgcatgtggtggtattttggttgctacttctgtctg
cccatcctcttcaccgtcacctgtcagctggtgacatggcgggtgcggggcccaccgggc
aggaagcctgagtgtagagcgggcagacatgagcagtgtgagagtcagcttaacagcacc
gtggtgggcctgactgtggtctatgccttctgtacgctccctgaaaacgtctgcaacatc
gtggtggcttacctctccactgagctcacgaggcagaccctggacctcctgggcctcatc
aaccagttctccacgttcttcaagggcgccatcactcccgtgctcctcctgtgcatctgc
aggccgctaggccaggccttcctggattgctgctgctgttgctgctgtgaagaatgtggt
ggggcatcagactcctcagccactgtcagcgcggacagcaagcttaaggccgaagtgtcc
tcctccatctacttccacaagcccagggagtcacccccactcctgcccctgggcacccct
tgctga

DBGET integrated database retrieval system