KEGG   Rattus norvegicus (rat): 25295Help
Entry
25295             CDS       T01003                                 

Gene name
Bglap, Bglap2, Bgp, Bgpr, Bgpra
Definition
(RefSeq) bone gamma-carboxyglutamate protein
  KO
K22609  osteocalcin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    25295 (Bglap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 25295
NCBI-ProteinID: NP_038200
RGD: 2206
Ensembl: ENSRNOG00000019607
Vega: OTTRNOG00000002061
UniProt: P04640
Position
2q34
AA seq 99 aa AA seqDB search
MRTLSLLTLLALTAFCLSDLAGAKPSDSESDKAFMSKQEGSKVVNRLRRYLNNGLGAPAP
YPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccctctctctgctcactctgctggccctgactgcattctgcctctctgacctg
gcaggtgcaaagcccagcgactctgagtctgacaaagccttcatgtccaagcaggagggc
agtaaggtggtgaatagactccggcgctacctcaacaatggacttggagccccagccccc
tacccagatcccctggagcctcacagggaggtgtgtgagctcaaccccaattgtgacgag
ctagcggaccacattggcttccaggacgcctacaagcgcatctatggcaccaccgtttag

DBGET integrated database retrieval system