KEGG   Rattus norvegicus (rat): 25296
Entry
25296             CDS       T01003                                 

Gene name
Bmp4
Definition
(RefSeq) bone morphogenetic protein 4 precursor
  KO
K04662  bone morphogenetic protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04919  Thyroid hormone signaling pathway
rno05200  Pathways in cancer
rno05217  Basal cell carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    25296 (Bmp4)
   04390 Hippo signaling pathway
    25296 (Bmp4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25296 (Bmp4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    25296 (Bmp4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    25296 (Bmp4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25296 (Bmp4)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    25296 (Bmp4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25296 (Bmp4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    25296 (Bmp4)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25296 (Bmp4)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   25296 (Bmp4)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   25296 (Bmp4)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 25296
NCBI-ProteinID: NP_036959
RGD: 2213
Ensembl: ENSRNOG00000009694
UniProt: Q6AYU9
Position
15
AA seq 408 aa
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEAT
LLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQSQGTGLEYPERPASRANTVRS
FHHEEHLENIPGTSESSAFRFFFNLSSIPENEVISSAELRLFREQVDQGPDWEQGFHRIN
IYEVMKPPAEMVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVT
HLHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHTLTRRRAKRSPKHHPQR
SRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTL
VNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgattcctggtaaccgaatgctgatggtcgttttattatgccaagtcctgctaggaggc
gcgagccatgctagtttgatacctgagaccgggaagaaaaaagtcgccgagattcagggc
cacgcgggaggacgccgctcagggcagagccatgagctcctgcgggacttcgaggcgaca
cttctgcagatgtttgggctgcgccgccgtccgcagccgagcaagagcgccgtcatcccg
gattacatgagggatctttaccggctccagtctggggaggaggaggaagaagagcagagc
cagggaaccgggcttgagtaccctgagcgtcctgccagcagagccaacactgtgaggagt
ttccatcacgaagaacatctggagaacatcccagggaccagtgagagctctgcttttcgt
ttcttctttaacctcagcagcatcccagagaatgaggtgatctcctctgcagagctccgg
ctatttcgggagcaggtggaccagggccctgactgggaacagggcttccaccgtataaac
atttatgaggttatgaagcccccagcagaaatggtgcctggacacctcatcacacgacta
ctggacaccagactagtccatcacaatgtgacacggtgggaaactttcgatgtgagccct
gcagtccttcgatggacccgggaaaagcaacccaactatgggctggccattgaggtgact
cacctccaccagacacggacccaccagggccaacatgtcaggattagccgatcgttacct
caagggagtggaaattgggcccaactccggcccctcctggtcacttttggccacgatggc
cggggtcataccttgacccgccggagggccaagcgtagtcccaagcatcacccacagcgc
tccaggaagaagaataagaactgccgtcgccattcgctctacgtggacttcagtgacgtg
ggctggaatgattggatcgtggccccaccgggctaccaggccttctactgccacggggac
tgtccctttccactggcggaccacctcaactcaaccaatcatgccattgtgcagaccctg
gtcaactccgttaattctagcatccctaaggcctgctgtgtccccaccgaactgagcgcc
atttccatgttgtatctggacgagtacgacaaggtggtgttgaaaaattatcaggagatg
gtggtggaggggtgcggatgccgctga

DBGET integrated database retrieval system