KEGG   Rattus norvegicus (rat): 25297Help
Entry
25297             CDS       T01003                                 

Gene name
Cacnb3, CACH3B
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit beta 3
  KO
K04864  voltage-dependent calcium channel beta-3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04921  Oxytocin signaling pathway
rno05410  Hypertrophic cardiomyopathy (HCM)
rno05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
rno05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25297 (Cacnb3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    25297 (Cacnb3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    25297 (Cacnb3)
   04261 Adrenergic signaling in cardiomyocytes
    25297 (Cacnb3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    25297 (Cacnb3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    25297 (Cacnb3)
   05414 Dilated cardiomyopathy (DCM)
    25297 (Cacnb3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25297 (Cacnb3)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   25297 (Cacnb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin VGCC_beta4Aa_N SH3_1
Motif
Other DBs
NCBI-GeneID: 25297
NCBI-ProteinID: NP_036960
RGD: 2248
Ensembl: ENSRNOG00000054274
UniProt: P54287
Structure
PDB: 

Position
7q36
AA seq 484 aa AA seqDB search
MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPV
AFAVRTNVSYCGVLDEECPVQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPS
PQRLESIRLKQEQKARRSGNPSSLSDIGNRRSPPPSLAKQKQKQAEHVPPYDVVPSMRPV
VLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLNNPGKRTIIER
SSARSSIAEVQSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFVKVSSPKVL
QRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLDDACEHLAEYLEVYWRAT
HHPAPGPGMLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQR
SSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHDHNDRNWQRNRPWP
KDSY
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtatgacgactcctacgtgcccgggtttgaggactcggaggcgggttcagccgactcc
tacaccagccgcccctctctggactcagacgtttccctggaggaggaccgggagagtgcc
cggcgagaagtggagagtcaggctcagcagcagctggaaagagccaagcacaaacctgtg
gcatttgctgtgaggaccaatgtcagctactgtggagttctggatgaggaatgcccagtc
cagggctctggagtcaacttcgaggccaaagattttctgcacattaaagagaagtacagc
aatgactggtggatcgggaggctagtgaaagaaggtggcgatattgccttcatccccagc
ccccaacgcctggagagcatccggctcaaacaggaacagaaggccaggagatccgggaac
ccttccagcctgagtgacattggcaaccgacgttcccctcctccatctctagccaagcag
aagcaaaagcaggcggaacatgtccccccgtatgatgtggtgccctccatgcggcctgtg
gtgctggtgggaccctctctgaaaggttatgaggtcacagacatgatgcagaaggctctc
ttcgacttccttaaacacaggtttgatggcaggatctccatcacccgcgtcacggctgac
ctctcactggccaagcgctctgtgctcaacaatcctggcaagaggaccatcatcgagcgc
tcttctgcccgctccagcattgctgaggtgcagagtgagattgagcgcatattcgagctg
gccaaatccctgcagctagtggtgttggatgctgacaccatcaaccacccagcacagcta
gccaagacctcactggcccccatcatcgtcttcgtcaaagtgtcctcgccaaaggtactg
cagcgactgatccgctccagggggaagtcccagatgaagcacctcactgtacagatgatg
gcatatgataagctggttcagtgcccacctgagtcatttgatgtgattctggatgagaac
cagctggacgacgcctgtgagcacctagctgaatacctagaggtttactggcgcgctacc
caccacccagcaccgggccccgggatgctgggtccgcccagtgccatccctggacttcag
aaccagcagctgctgggggagcgaggtgaggagcattcacccctggagcgggacagtttg
atgccctcggatgaggccagtgagagctcccgccaggcctggaccggatcttcacagcgc
agctcccgccatctggaggaggactatgcagatgcctaccaggacctgtaccagcctcac
cgtcaacacacctcggggctacccagtgctaacgggcatgacccccaagaccggctccta
gcccaggactcggagcatgaccacaatgaccggaactggcagcgtaaccggccttggcct
aaggacagctactga

DBGET integrated database retrieval system