KEGG   Rattus norvegicus (rat): 252971
Entry
252971            CDS       T01003                                 

Gene name
Socs1
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno04380  Osteoclast differentiation
rno04630  JAK-STAT signaling pathway
rno04910  Insulin signaling pathway
rno04917  Prolactin signaling pathway
rno04930  Type II diabetes mellitus
rno04935  Growth hormone synthesis, secretion and action
rno05145  Toxoplasmosis
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    252971 (Socs1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    252971 (Socs1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    252971 (Socs1)
   04917 Prolactin signaling pathway
    252971 (Socs1)
   04935 Growth hormone synthesis, secretion and action
    252971 (Socs1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    252971 (Socs1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    252971 (Socs1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    252971 (Socs1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    252971 (Socs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    252971 (Socs1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     252971 (Socs1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 252971
NCBI-ProteinID: NP_665886
RGD: 69272
Ensembl: ENSRNOG00000002568
UniProt: G3V6B4
Position
10
AA seq 212 aa
MVARNQVAADNAISPASEPRRRPEPSSSSSSSSPAAPARPRPCPVVPAPAPGDTHFRTFR
SHSDYRRITRTSALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKM
ASGPTSIRVHFQAGRFHLDGSRETFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCR
QRIVAAVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 639 nt   +upstreamnt  +downstreamnt
atggtagcacgtaaccaggtggcagccgacaatgcgatctccccggcatcagagccccga
cggcggccagagccatcctcgtcctcgtcttcgtcctcgccggcggccccggcgcgtccc
cggccctgcccggtggtcccggccccggctccgggcgacactcacttccgcaccttccgc
tcccactctgattaccggcgcatcacgcggaccagcgctctcctggacgcctgcggcttc
tactggggacccctgagcgtgcatggggcgcacgaacggctgcgtgccgagcccgtgggc
accttcttggtgcgcgacagtcgccagcggaactgcttcttcgcgctcagcgtgaagatg
gcttcgggccccacgagcattcgtgtgcacttccaggccggccgcttccacctggacggc
agccgcgagaccttcgactgcctcttcgagctgctggagcactacgtggcggcgccgcgc
cgcatgttgggggccccactgcgccagcgccgcgtgcggccgctgcaggagctgtgtcgc
cagcgcatcgtggccgccgtgggtcgcgagaacctggcacgcatccctcttaacccggta
ctccgtgactacctgagttccttccccttccagatctga

DBGET integrated database retrieval system