KEGG   Rattus norvegicus (rat): 25298Help
Entry
25298             CDS       T01003                                 

Gene name
Cck
Definition
(RefSeq) cholecystokinin
  KO
K05226  cholecystokinin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04911  Insulin secretion
rno04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25298 (Cck)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    25298 (Cck)
  09154 Digestive system
   04972 Pancreatic secretion
    25298 (Cck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gastrin
Motif
Other DBs
NCBI-GeneID: 25298
NCBI-ProteinID: NP_036961
RGD: 2288
Ensembl: ENSRNOG00000019321
UniProt: P01355
Position
8q32
AA seq 115 aa AA seqDB search
MKCGVCLCVVMAVLAAGALAQPVVPVEAVDPMEQRAEEAPRRQLRAVLRPDSEPRARLGA
LLARYIQQVRKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDFGRRSAEDYEYPS
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcggcgtgtgtctgtgcgtggtgatggcagtcctggcagcaggcgccctggcg
cagccggtagtccctgtagaagctgtggaccctatggagcagcgggcggaggaggcgccc
cgaaggcagctgagggctgtgctccgaccggacagcgagccccgagcgcgcctgggcgca
ctgctagcccgatacatccagcaggtccgcaaagctccctctggccgcatgtccgttctt
aagaacctgcagggcctggaccctagccataggataagtgaccgggactacatgggctgg
atggatttcggccggcgcagtgctgaggactacgaatacccatcgtag

DBGET integrated database retrieval system