KEGG   Rattus norvegicus (rat): 25300
Entry
25300             CDS       T01003                                 

Gene name
Cd247
Definition
(RefSeq) T-cell surface glycoprotein CD3 zeta chain isoform 2 precursor
  KO
K06453  CD3Z antigen, zeta polypeptide
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno05142  Chagas disease
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    25300 (Cd247)
   04660 T cell receptor signaling pathway
    25300 (Cd247)
   04658 Th1 and Th2 cell differentiation
    25300 (Cd247)
   04659 Th17 cell differentiation
    25300 (Cd247)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    25300 (Cd247)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    25300 (Cd247)
   05169 Epstein-Barr virus infection
    25300 (Cd247)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    25300 (Cd247)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25300 (Cd247)
   04090 CD molecules [BR:rno04090]
    25300 (Cd247)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   25300 (Cd247)
CD molecules [BR:rno04090]
 Proteins
  25300 (Cd247)
SSDB
Motif
Pfam: TCR_zetazeta ITAM
Other DBs
NCBI-GeneID: 25300
NCBI-ProteinID: NP_001192233
RGD: 2305
Ensembl: ENSRNOG00000003298
UniProt: Q4V7G0 M0R576
Position
13
AA seq 137 aa
MKWTASVLACILQVQFPGAEAQSFGLLDPKLCYMLDGILFIYGVIVTALYLRAKFSRSAD
AAAYLQDPNQLYNQRRRNPQEGVYNALQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLST
ATKDTYDALHMQTLPPR
NT seq 414 nt   +upstreamnt  +downstreamnt
atgaagtggacggcatcagtcctcgcctgcatccttcaagtgcagttcccaggagcagag
gcacagagctttggtctgctggatcccaaactctgctatatgctagatggaatcctcttc
atctacggagtcatcgtcacggccctgtacctgagagcaaaattcagcaggagtgcagat
gctgctgcttaccttcaggaccccaaccagctctataaccagaggaggaggaacccccag
gaaggcgtgtacaatgcactgcagaaagacaagatggcagaggcctacagtgagattggc
atgaaaggcgagaggcggagaggcaaggggcacgacggcctttaccagggtctcagcact
gccaccaaggacacctatgacgccctgcatatgcagaccctgccccctcgctaa

DBGET integrated database retrieval system