KEGG   Rattus norvegicus (rat): 25300
Entry
25300             CDS       T01003                                 

Gene name
Cd247
Definition
(RefSeq) T-cell surface glycoprotein CD3 zeta chain isoform 2 precursor
  KO
K06453  CD3Z antigen, zeta polypeptide
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno05142  Chagas disease
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    25300 (Cd247)
   04660 T cell receptor signaling pathway
    25300 (Cd247)
   04658 Th1 and Th2 cell differentiation
    25300 (Cd247)
   04659 Th17 cell differentiation
    25300 (Cd247)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    25300 (Cd247)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    25300 (Cd247)
   05169 Epstein-Barr virus infection
    25300 (Cd247)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    25300 (Cd247)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25300 (Cd247)
   04090 CD molecules [BR:rno04090]
    25300 (Cd247)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   25300 (Cd247)
CD molecules [BR:rno04090]
 Proteins
  25300 (Cd247)
SSDB
Motif
Pfam: TCR_zetazeta ITAM
Other DBs
NCBI-GeneID: 25300
NCBI-ProteinID: NP_001192233
RGD: 2305
Ensembl: ENSRNOG00000003298
UniProt: Q4V7G0 M0R576
Position
13
AA seq 137 aa
MKWTASVLACILQVQFPGAEAQSFGLLDPKLCYMLDGILFIYGVIVTALYLRAKFSRSAD
AAAYLQDPNQLYNQRRRNPQEGVYNALQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLST
ATKDTYDALHMQTLPPR
NT seq 414 nt   +upstreamnt  +downstreamnt
atgaagtggacggcatcagtcctcgcctgcatccttcaagtgcagttcccaggagcagag
gcacagagctttggtctgctggatcccaaactctgctatatgctagatggaatcctcttc
atctacggagtcatcgtcacggccctgtacctgagagcaaaattcagcaggagtgcagat
gctgctgcttaccttcaggaccccaaccagctctataaccagaggaggaggaacccccag
gaaggcgtgtacaatgcactgcagaaagacaagatggcagaggcctacagtgagattggc
atgaaaggcgagaggcggagaggcaaggggcacgacggcctttaccagggtctcagcact
gccaccaaggacacctatgacgccctgcatatgcagaccctgccccctcgctaa

KEGG   Rattus norvegicus (rat): 25710
Entry
25710             CDS       T01003                                 

Gene name
Cd3d
Definition
(RefSeq) T-cell surface glycoprotein CD3 delta chain precursor
  KO
K06450  T-cell surface glycoprotein CD3 delta chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04640  Hematopoietic cell lineage
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno05142  Chagas disease
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    25710 (Cd3d)
   04660 T cell receptor signaling pathway
    25710 (Cd3d)
   04658 Th1 and Th2 cell differentiation
    25710 (Cd3d)
   04659 Th17 cell differentiation
    25710 (Cd3d)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    25710 (Cd3d)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25710 (Cd3d)
   05170 Human immunodeficiency virus 1 infection
    25710 (Cd3d)
   05162 Measles
    25710 (Cd3d)
   05169 Epstein-Barr virus infection
    25710 (Cd3d)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    25710 (Cd3d)
  09163 Immune disease
   05340 Primary immunodeficiency
    25710 (Cd3d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25710 (Cd3d)
CD molecules [BR:rno04090]
 Proteins
  25710 (Cd3d)
SSDB
Motif
Pfam: Ig_4 ITAM Ig_5 DAP10
Other DBs
NCBI-GeneID: 25710
NCBI-ProteinID: NP_037301
RGD: 2304
Ensembl: ENSRNOG00000015994
UniProt: P19377
Position
8
AA seq 173 aa
MEHYGILVSLLLATVLPQGSPFKIEVVEYEDKVFVNCNTSIRHLDGSVERWLTKNKSLIL
GKGILDPRGMYMCNGTEELAKEVSTVQVYYRMCQNCVELDSATLAGVIITDLIATLLLAL
GVYCFAGHETGRLSGAVDTQVLLKNEQLYQPLRDRDDAQYSRLGGNWPRNKRS
NT seq 522 nt   +upstreamnt  +downstreamnt
atggagcactatggaattctggttagtctgctactggctactgttctcccccaagggagc
cccttcaagatagaagtggttgaatatgaggacaaagtgtttgtgaattgcaacaccagc
atcaggcatctagatggatcagtggaaagatggttgaccaaaaataaatcactcatcttg
ggcaaaggcatcctggacccacgagggatgtatatgtgtaatgggacagaggagctggcg
aaggaggtgtcgactgttcaagtatattaccgaatgtgccagaactgtgtggagctggac
tcagccaccctggctggtgtcatcatcactgatctcatcgccactctgctcctggctttg
ggggtctactgctttgcaggccatgagaccggaagactttctggggctgttgacactcaa
gtcctgttgaagaacgagcagctgtatcagcctcttcgagatcgcgatgatgcccagtac
agccgtcttggagggaactggccccggaacaaaaggtcttga

KEGG   Rattus norvegicus (rat): 300678
Entry
300678            CDS       T01003                                 

Gene name
Cd3g
Definition
(RefSeq) T-cell surface glycoprotein CD3 gamma chain precursor
  KO
K06452  T-cell surface glycoprotein CD3 gamma chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04640  Hematopoietic cell lineage
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno05142  Chagas disease
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    300678 (Cd3g)
   04660 T cell receptor signaling pathway
    300678 (Cd3g)
   04658 Th1 and Th2 cell differentiation
    300678 (Cd3g)
   04659 Th17 cell differentiation
    300678 (Cd3g)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    300678 (Cd3g)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    300678 (Cd3g)
   05170 Human immunodeficiency virus 1 infection
    300678 (Cd3g)
   05162 Measles
    300678 (Cd3g)
   05169 Epstein-Barr virus infection
    300678 (Cd3g)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    300678 (Cd3g)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    300678 (Cd3g)
CD molecules [BR:rno04090]
 Proteins
  300678 (Cd3g)
SSDB
Motif
Pfam: Ig_4 Ig_5 ITAM Ig_3
Other DBs
NCBI-GeneID: 300678
NCBI-ProteinID: NP_001071114
RGD: 1307718
Ensembl: ENSRNOG00000015945
UniProt: Q64159
Position
8
AA seq 182 aa
MEQGKGLAGLFLVISLLQGTMAQQKEEKHLVKVDDSQGDGSVLLTCDFNEKTITWLKDGH
RISPPNATKSTWNLGNGAKDPRGMYQCRGAKKKSQLLQVYYRLCENCIELNMGTVSGFIF
AEIISIFFLAVGVYFIAGQDGVRQSRASDKQTLLQNEQVYQPLKDREYEQYSRLQGNQVR
KK
NT seq 549 nt   +upstreamnt  +downstreamnt
atggagcaggggaaaggtttggctggcctcttcctggtgatctctcttcttcaaggcacc
atggcccagcaaaaagaagaaaagcatttggtaaaagtggatgacagccaaggagatggc
tctgtacttctgacttgtgacttcaatgagaagactatcacatggcttaaagatgggcac
agaataagtcctccaaatgcaactaaaagcacgtggaatctgggcaacggtgccaaagac
cctcgaggcatgtatcagtgccgaggagcaaagaagaagtcgcagctcctgcaagtgtac
tacagactgtgtgagaactgcattgagctaaatatgggcactgtgtccggctttatcttc
gctgaaatcatcagcattttcttccttgctgttggtgtatacttcattgctggacaggat
ggagttcgccagtcaagagcttcagacaagcagactctgttgcaaaatgaacaggtctac
cagcccctcaaggaccgggaatatgaacagtacagccgtctccaaggaaaccaagtgaga
aagaagtga

KEGG   Rattus norvegicus (rat): 315609
Entry
315609            CDS       T01003                                 

Gene name
Cd3e
Definition
(RefSeq) T-cell surface glycoprotein CD3 epsilon chain precursor
  KO
K06451  T-cell surface glycoprotein CD3 epsilon chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04640  Hematopoietic cell lineage
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno05142  Chagas disease
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    315609 (Cd3e)
   04660 T cell receptor signaling pathway
    315609 (Cd3e)
   04658 Th1 and Th2 cell differentiation
    315609 (Cd3e)
   04659 Th17 cell differentiation
    315609 (Cd3e)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    315609 (Cd3e)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    315609 (Cd3e)
   05170 Human immunodeficiency virus 1 infection
    315609 (Cd3e)
   05162 Measles
    315609 (Cd3e)
   05169 Epstein-Barr virus infection
    315609 (Cd3e)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    315609 (Cd3e)
  09163 Immune disease
   05340 Primary immunodeficiency
    315609 (Cd3e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    315609 (Cd3e)
CD molecules [BR:rno04090]
 Proteins
  315609 (Cd3e)
SSDB
Motif
Pfam: Ig_5 Ig_4 ITAM Ig_2 m04gp34like Ig_3 ig DUF3404
Other DBs
NCBI-GeneID: 315609
NCBI-ProteinID: NP_001101610
RGD: 1309222
Ensembl: ENSRNOG00000016069
UniProt: D4A5M2
Position
8
AA seq 188 aa
MQWNAFWSILGLSLLAVGTCQEEYEVSISGTSVELTCPLENEDNLKWEKNDKVLPDKNEK
HLVLEDFSEVKDSGYYVCYTESSRKNTYLYLKARVCENCMEVDLTAVSIIIIVDICITLG
LLMVVYYWSKKRKAKAKPVTRGTGTGGRPRGKAQGQNKERPPPVPNPDYEPIRKGQRDLY
SGLNQRAV
NT seq 567 nt   +upstreamnt  +downstreamnt
atgcagtggaacgctttctggagcatcctgggcctcagcctcctagcagttggcacttgc
caggaagagtatgaagtctccatctcaggaaccagtgtagagctgacgtgccctctagag
aatgaggacaacttaaagtgggagaaaaatgacaaagtcctgcctgataagaatgagaaa
cacctggtgctagaggatttctcggaagtcaaggacagtggttactatgtctgctacaca
gaaagctcaaggaaaaacacgtacctgtacctgaaagccagagtgtgcgagaactgcatg
gaggtggacctgacagcagtatccataatcatcattgttgacatctgcatcactctgggc
ttgctgatggtcgtttattactggagcaagaaaaggaaggccaaggccaagcctgtgacc
cgaggaactggtactggtggcaggcccagaggtaaagcccaggggcaaaacaaggagcgg
ccgccacctgttcccaacccagactatgagcccatccgaaaaggccaacgggacctgtat
tctggcctgaatcagagagcagtctga

DBGET integrated database retrieval system