KEGG   Rattus norvegicus (rat): 25302Help
Entry
25302             CDS       T01003                                 

Gene name
Chrna7, BTX, NARAD, nAChRa7
Definition
(RefSeq) cholinergic receptor nicotinic alpha 7 subunit
  KO
K04809  nicotinic acetylcholine receptor alpha-7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04725  Cholinergic synapse
rno05033  Nicotine addiction
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    25302 (Chrna7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25302 (Chrna7)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    25302 (Chrna7)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    25302 (Chrna7)
  09165 Substance dependence
   05033 Nicotine addiction
    25302 (Chrna7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25302 (Chrna7)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   25302 (Chrna7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb SUR7
Motif
Other DBs
NCBI-GeneID: 25302
NCBI-ProteinID: NP_036964
RGD: 2348
Ensembl: ENSRNOG00000010853
UniProt: Q05941
Position
1q22
AA seq 502 aa AA seqDB search
MCGGRGGIWLALAAALLHVSLQGEFQRRLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDL
QMQEADISSYIPNGEWDLMGIPGKRNEKFYECCKEPYPDVTYTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLRYHHHDPDGGKMPKWTRIILLNWCAWFLRMKRPGEDKVRPACQHK
PRRCSLASVELSAGAGPPTSNGNLLYIGFRGLEGMHCAPTPDSGVVCGRLACSPTHDEHL
MHGAHPSDGDPDLAKILEEVRYIANRFRCQDESEVICSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcgggcggggaggcatctggctggctctggccgcggcgctgctgcacgtgtcc
ctgcaaggcgagttccagaggaggctgtacaaggagctggtcaagaactacaacccgctg
gagaggccggtggccaacgactcgcagccgctcaccgtgtacttctccctgagtctcctg
cagatcatggatgtggatgagaagaaccaagttttaaccaccaacatttggctacaaatg
tcttggacagatcactatttgcagtggaacatgtctgagtaccccggagtgaagaatgtt
cgttttccagatggccagatttggaaaccagacattctcctctataacagtgctgatgag
cgctttgatgccacgttccacaccaatgttttggtgaatgcatctgggcattgccagtat
ctccctccaggcatattcaagagctcctgctacattgacgttcgctggttcccttttgat
gtgcagcagtgcaaactgaagtttgggtcctggtcctatggagggtggtcactggacctg
caaatgcaagaggcagatatcagcagctatatccccaacggagaatgggatctcatggga
atccctggcaaaaggaatgagaagttctatgagtgctgcaaagagccatacccagatgtc
acctacacagtaaccatgcgccgtaggacactctactatggcctcaatctgctcatccct
tgtgtactcatttcagccctggctctgctggtattcttgctgcctgcagactctggagag
aaaatctctcttggaataactgtcttactttctctgactgtcttcatgctgcttgtggct
gagatcatgccagcaacatctgattctgtgcccttgatagcacaatacttcgccagcacc
atgatcatcgtgggcctctctgtagtggtgacagtgattgtgctgagatatcaccaccat
gaccctgatggtggcaaaatgcctaagtggaccagaatcattctcctgaactggtgtgca
tggtttctgcgcatgaagaggcccggagaggacaaggtgcggccagcttgtcagcacaag
cctcggcgctgcagcctggccagtgtggagctgagtgcaggtgctgggccacccaccagc
aatggcaacctgctctacattggcttccgaggcctggagggcatgcactgtgccccaact
ccagactctggggtcgtatgtggccgtttggcctgctccccaacacatgatgagcacctc
atgcacggtgcacacccctctgatggggaccccgacctggccaagatcctggaggaggtc
cgctacatcgccaaccgcttccgctgccaggacgagagtgaggtgatctgcagtgaatgg
aagtttgcagcctgcgtggtggaccgcttgtgcctcatggccttttcggtctttaccatc
atctgtaccatcggcatcctcatgtcagctccaaactttgtggaggctgtgtccaaagac
tttgcttaa

DBGET integrated database retrieval system