KEGG   Rattus norvegicus (rat): 25303Help
Entry
25303             CDS       T01003                                 

Gene name
Abcc2, Cmoat, Mrp2, cMRP, mrp
Definition
(RefSeq) ATP binding cassette subfamily C member 2
  KO
K05666  ATP-binding cassette, subfamily C (CFTR/MRP), member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01523  Antifolate resistance
rno01524  Platinum drug resistance
rno02010  ABC transporters
rno04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    25303 (Abcc2)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    25303 (Abcc2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    25303 (Abcc2)
   01523 Antifolate resistance
    25303 (Abcc2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25303 (Abcc2)
Transporters [BR:rno02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    25303 (Abcc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N MMR_HSR1 AAA_16 RsgA_GTPase DUF87 AAA_29 Dynamin_N MeaB FKBP_N_2
Motif
Other DBs
NCBI-GeneID: 25303
NCBI-ProteinID: NP_036965
RGD: 2366
Ensembl: ENSRNOG00000046727
UniProt: Q63120
Position
1q54
AA seq 1541 aa AA seqDB search
MDKFCNSTFWDLSLLESPEADLPLCFEQTVLVWIPLGFLWLLAPWQLYSVYRSRTKRSSI
TKFYLAKQVFVVFLLILAAIDLSLALTEDTGQATVPPVRYTNPILYLCTWLLVLAVQHSR
QWCVRKNSWFLSLFWILSVLCGVFQFQTLIRALLKDSKSNMAYSYLFFVSYGFQIVLLIL
TAFSGPSDSTQTPSVTASFLSSITFSWYDRTVLKGYKHPLTLEDVWDIDEGFKTRSVTSK
FEAAMTKDLQKARQAFQRRLQKSQRKPEATLHGLNKKQSQSQDVLVLEEAKKKSEKTTKD
YPKSWLIKSLFKTFHVVILKSFILKLIHDLLVFLNPQLLKLLIGFVKSSNSYVWFGYICA
ILMFAVTLIQSFCLQSYFQHCFVLGMCVRTTVMSSIYKKALTLSNLARKQYTIGETVNLM
SVDSQKLMDATNYMQLVWSSVIQITLSIFFLWRELGPSILAGVGVMVLLIPVNGVLATKI
RNIQVQNMKNKDKRLKIMNEILSGIKILKYFAWEPSFQEQVQGIRKKELKNLLRFGQLQS
LLIFILQITPILVSVVTFSVYVLVDSANVLNAEKAFTSITLFNILRFPLSMLPMVTSSIL
QASVSVDRLERYLGGDDLDTSAIRRVSNFDKAVKFSEASFTWDPDLEATIQDVNLDIKPG
QLVAVVGTVGSGKSSLVSAMLGEMENVHGHITIQGSTAYVPQQSWIQNGTIKDNILFGSE
YNEKKYQQVLKACALLPDLEILPGGDMAEIGEKGINLSGGQKQRVSLARAAYQDADIYIL
DDPLSAVDAHVGKHIFNKVVGPNGLLAGKTRIFVTHGIHFLPQVDEIVVLGKGTILEKGS
YRDLLDKKGVFARNWKTFMKHSGPEGEATVNNDSEAEDDDDGLIPTMEEIPEDAASLAMR
RENSLRRTLSRSSRSSSRRGKSLKNSLKIKNVNVLKEKEKEVEGQKLIKKEFVETGKVKF
SIYLKYLQAVGWWSILFIILFYGLNNVAFIGSNLWLSAWTSDSDNLNGTNNSSSHRDMRI
GVFGALGLAQGICLLISTLWSIYACRNASKALHGQLLTNILRAPMRFFDTTPTGRIVNRF
SGDISTVDDLLPQTLRSWMMCFFGIAGTLVMICMATPVFAIIIIPLSILYISVQVFYVAT
SRQLRRLDSVTKSPIYSHFSETVTGLPIIRAFEHQQRFLAWNEKQIDINQKCVFSWITSN
RWLAIRLELVGNLVVFCSALLLVIYRKTLTGDVVGFVLSNALNITQTLNWLVRMTSEAET
NIVAVERISEYINVENEAPWVTDKRPPADWPRHGEIQFNNYQVRYRPELDLVLKGITCNI
KSGEKVGVVGRTGAGKSSLTNCLFRILESAGGQIIIDGIDVASIGLHDLRERLTIIPQDP
ILFSGSLRMNLDPFNKYSDEEVWRALELAHLRSFVSGLQLGLLSEVTEGGDNLSIGQRQL
LCLGRAVLRKSKILVLDEATAAVDLETDSLIQTTIRKEFSQCTVITIAHRLHTIMDSDKI
MVLDNGKIVEYGSPEELLSNRGSFYLMAKEAGIENVNHTEL
NT seq 4626 nt NT seq  +upstreamnt  +downstreamnt
atggacaagttctgcaactctactttttgggatctctcattactggaaagtccagaggct
gacctgcctctttgttttgagcaaactgttctggtgtggattcccttgggctttctttgg
ctcctggctccttggcaactttacagcgtgtacagatccaggaccaagagatcttctata
accaaattctaccttgccaagcaggtgttcgtcgtgtttcttcttattttagcagccata
gacctgtctcttgcgctcacagaagatactggacaagccacagttcctcctgtcagatat
acgaatccaatcctctacctgtgcacatggctcctggttttggcagtccagcacagcagg
caatggtgtgtacgaaagaactcttggttcctgtctctgttctggatcctctcggtctta
tgcggcgtattccagtttcagactctgatacgagcactcctgaaggacagcaagtccaac
atggcctactcctacctgttcttcgtctcctacggtttccagattgtcctcctgattctt
acagccttttcaggaccaagtgactcaacacaaactccatcagtcacggcttcctttctg
agtagcattacatttagttggtatgacaggactgttctgaaaggttacaagcatccactg
acactagaagatgtctgggatatcgatgaagggtttaaaacaaggtcagtcaccagcaag
tttgaggcggccatgacaaaggacctgcagaaagccaggcaggcttttcagaggcggctg
cagaagtcccagcggaaacctgaggccacactacacggactgaacaagaagcagagtcag
agccaagacgttctcgtcctggaagaagcgaaaaagaagtctgagaagaccaccaaagac
tatcccaaatcgtggttgatcaagtctctcttcaaaaccttccacgtagtgatcctgaaa
tcatttatactgaaattaatacatgaccttttggtgtttctgaatcctcagctgctgaag
ttgctgatcggtttcgtgaagagctctaactcatacgtgtggtttggctatatctgtgca
atcctaatgtttgctgtgactctcatccaatctttctgccttcagtcttactttcaacat
tgttttgtgttgggaatgtgcgtacggacaaccgtcatgtcttcgatatataagaaggca
ttgaccctatctaacttggctaggaagcagtacaccattggagagacggtgaacttgatg
tctgtagattcccagaagctaatggatgcgaccaactacatgcagttggtgtggtcaagt
gttatacagattactttgtccatcttcttcctgtggagagagttgggaccgtccatctta
gcaggtgttggggttatggttctcctaatcccagttaatggagttctggctaccaagatc
agaaatattcaggtccaaaatatgaagaataaagacaaacgtttaaaaatcatgaatgag
attctcagtggaatcaagatcctgaaatactttgcctgggaaccttcatttcaagagcaa
gtccagggcattcggaagaaagaactcaagaacttgctgcggttcggccagctgcagagt
ctgctgatcttcattttacagataactccaatcctggtgtctgtggtcacattttctgtc
tatgtcctggtggatagcgccaatgttttgaatgcggagaaggcatttacctccatcacc
ctcttcaatatcctacgcttccctctgtccatgcttcccatggtgacctcatcgatcctc
caggccagtgtttctgtggaccggctggagaggtatttgggaggagacgatttagacaca
tctgccattcgccgcgtcagcaattttgataaagctgtgaagttttcagaggcctctttt
acttgggacccggacttggaagccacaatccaagatgtgaacctggacataaagccaggc
caactggtggctgtggtgggcactgtaggctctgggaaatcctctttggtatcagccatg
ctgggagaaatggaaaacgttcacgggcacatcaccatccagggatccacagcctatgtc
cctcagcagtcctggattcagaatggaaccatcaaagacaacatcctgtttgggtccgaa
tacaatgaaaagaagtaccagcaagttctcaaagcatgcgctctcctcccagacttggaa
atattgcctggaggagacatggctgagatcggagagaaggggataaatctcagtggtggt
cagaagcagcgagtcagcctggccagagctgcctatcaagatgctgacatctatattctg
gacgatcccctgtcggctgtggatgctcatgtgggaaaacacattttcaacaaggttgtg
ggccccaacggcctgttggctggcaagacgagaatctttgttactcatggtattcacttc
cttccccaagtggatgagattgtagttctggggaaaggcaccatcttagagaaaggatcc
tatcgtgacctgttggacaagaagggagtgtttgctaggaactggaagaccttcatgaag
cattcagggcctgaaggagaggccacagtcaataatgacagtgaggcggaagacgacgat
gatgggctgattcccaccatggaggaaatccctgaggatgcagcttccttggccatgaga
agagaaaatagtcttcgccgtacactgagccgcagctctaggtccagcagccgacgtggg
aagtccctcaaaaactccttgaagattaaaaatgtgaatgtcttgaaggagaaggaaaaa
gaagtggaaggacaaaaactaattaagaaagaatttgtggaaaccgggaaggtcaagttc
tccatctacctgaagtatctacaggcagtagggtggtggtccatacttttcatcatcctt
ttctacggattgaataatgttgcttttatcggctctaacctctggctgagtgcttggacc
agtgactctgacaacttgaatgggaccaacaattcgtcttctcatagggacatgagaatt
ggggtctttggagctctgggattagcacaaggtatatgtttgcttatttcaactctgtgg
agcatatatgcttgcagaaatgcatcaaaagctttgcacgggcagctgttaaccaacatc
ctccgggcacccatgaggttttttgacacaactcccacaggccggattgtgaacagattt
tctggtgatatttctactgtggacgacttgctcccccagacacttcgaagctggatgatg
tgtttctttggcatcgctggcactcttgtcatgatctgcatggccaccccagtcttcgct
atcatcatcattcctctcagcattctttatatttcggtgcaggttttttatgtggctact
tcccgccagctgagacggttggattctgtcaccaaatctccgatctattctcacttcagt
gagactgtcacaggtttgcccattatccgtgcctttgagcaccagcagcgatttctagct
tggaatgagaagcagattgacatcaaccagaaatgtgtcttttcctggattacctccaac
aggtggcttgcaattcggctggagctggttggaaacttggtcgtcttctgttccgccttg
ctgctggttatttatagaaaaaccttaaccggggacgttgtgggctttgttctgtccaac
gccctcaatatcacacaaaccttgaactggctagtgaggatgacgtcagaagcagagacc
aacattgtggcagttgagcgaataagtgaatacataaatgtagagaatgaggcgccctgg
gtgactgacaagaggcctccggcagactggcccagacatggtgagatccagtttaacaac
tatcaagtgcggtatcggccggagctggatctggtactgaaagggatcacttgtaacatc
aagagcggagagaaggtcggcgtagtgggcaggactggggctgggaaatcatccctcaca
aactgcctcttcagaatcttagagtctgcggggggccagatcatcattgatgggatagat
gttgcctccattggactgcacgaccttcgagagaggctgaccatcattccccaggacccc
attttgttctcggggagtctgaggatgaatctcgaccctttcaacaaatattcagatgag
gaggtttggagggccctggagttggctcacctcagatcctttgtgtctggcctacagctt
gggttgttatccgaagtgacagagggtggtgacaacctgagcatagggcagaggcagctc
ctatgcctgggcagggctgtgcttcgaaaatccaaaatcctggtcctggatgaagccacg
gctgcagtggatctcgagacggatagcctcattcagacgaccatccgaaaggagttctcc
cagtgcacggtcatcaccatcgctcacaggctgcacaccatcatggacagtgacaagata
atggtcctagacaacgggaagattgtcgagtatggcagtcctgaagaactgctgtccaac
agaggttccttctatctgatggccaaggaagccggcattgaaaatgtgaatcacacagag
ctctag

DBGET integrated database retrieval system