KEGG   Rattus norvegicus (rat): 25304Help
Entry
25304             CDS       T01003                                 

Gene name
Comp
Definition
(RefSeq) cartilage oligomeric matrix protein
  KO
K04659  thrombospondin 2/3/4/5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno05144  Malaria
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    25304 (Comp)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    25304 (Comp)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    25304 (Comp)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25304 (Comp)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    25304 (Comp)
  09174 Infectious disease: parasitic
   05144 Malaria
    25304 (Comp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25304 (Comp)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25304 (Comp)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25304 (Comp)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Opsonins
    25304 (Comp)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25304 (Comp)
  Exosomal proteins of colorectal cancer cells
   25304 (Comp)
  Exosomal proteins of bladder cancer cells
   25304 (Comp)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   25304 (Comp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA cEGF EGF_3 EGF_MSP1_1 hEGF
Motif
Other DBs
NCBI-GeneID: 25304
NCBI-ProteinID: NP_036966
RGD: 2378
Ensembl: ENSRNOG00000048472
Vega: OTTRNOG00000001988
UniProt: P35444
Structure
PDB: 

Position
16p14
AA seq 755 aa AA seqDB search
MSPTACVLVLALAALRATGQGQIPLGGDLAPQMLRELQETNAALQDVRELLRHRVKEITF
LKNTVMECDACGMQPARTPGLSVRPVALCAPGSCFPGVVCTETATGARCGPCPPGYTGNG
SHCTDVNECNAHPCFPRVRCINTSPGFHCEACPPGFSGPTHEGVGLTFAKTNKQVCTDIN
ECETGQHNCVPNSVCVNTRGSFQCGPCQPGFVGDQRSGCQRRGQHFCPDGSPSPCHEKAD
CILERDGSRSCVCAVGWAGNGLLCGRDTDLDGFPDEKLRCSERQCRKDNCVTVPNSGQED
VDRDRIGDACDPDADGDGVPNEQDNCPLVRNPDQRNSDKDKWGDACDNCRSQKNDDQKDT
DRDGQGDACDDDIDGDRIRNVADNCPRVPNFDQSDSDGDGVGDACDNCPQKDNPDQRDVD
HDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQQDSDHDGKGDACDDDDDNDGVPDSRD
NCRLVPNPGQEDNDRDGVGDACQGDFDADKVIDKIDVCPENAEVTLTDFRAFQTVVLDPE
GDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTATDDDYAGFIFG
YQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTAS
QVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTAMRGGRL
GVFCFSQENIIWANLRYRCNDTIPEDYERHRLRRA
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgagccccactgcctgcgttctagtgctcgccctggctgccttgcgggctaccggccag
ggccagatcccgctgggtggagacctagccccacagatgcttcgagaactccaggagact
aatgcggcgctgcaagacgtgagagagctcttgcgacacagggtcaaggagatcaccttc
ctgaagaatacggtgatggaatgtgacgcttgcggaatgcagcccgcacgcacccccggt
ctgagcgtgcggccagtcgcgctctgcgcacccggctcctgcttccctggcgtagtctgc
acggagacagctaccggcgcgcgctgcggcccctgccctccgggctacaccggcaacggc
tcgcactgcaccgacgttaatgagtgcaacgctcacccctgtttcccgcgcgtgcggtgc
atcaataccagccctggctttcactgcgaagcctgtccccctgggttcagcgggcccacc
cacgagggtgtggggctgaccttcgccaagaccaacaaacaagtttgcacagatattaat
gagtgtgagaccgggcagcacaattgcgttcccaactccgtgtgcgtcaacacccggggc
tccttccagtgcggtccctgccagcccggcttcgtgggcgaccagaggtcaggctgccag
cggcgtgggcaacacttctgccccgacgggtcacccagcccgtgccatgagaaagcagac
tgtattttggagcgcgacggctcaaggtcctgcgtgtgtgcggtcggctgggccggcaac
gggctcctgtgcggacgcgacacagacctggacggtttcccggacgagaagcttcgctgc
tcagagcgccagtgccgcaaggacaactgcgtgacggtgcccaattcagggcaggaggat
gtggaccgggaccgcattggagatgcttgtgacccggatgcggacggggatggagtccct
aatgagcaagacaattgcccgctggttcgaaacccagaccagcgcaactccgataaagac
aagtggggagatgcctgcgacaactgccggtcccagaagaatgatgaccagaaagataca
gaccgggatggccagggcgatgcctgcgacgacgacatagatggcgatcgaatccgaaat
gtagctgacaactgtccccgggtgcccaactttgaccagagtgacagcgatggtgatggt
gttggggatgcctgtgacaattgtccccagaaagacaacccggaccagagggacgtggac
cacgactttgtgggtgatgcctgtgacagtgaccaagaccaggacggggatggacaccaa
gactcccgggacaactgccccacagtgcccaacagtgcccagcaggactcagaccatgat
ggcaagggtgatgcctgtgatgatgacgacgacaatgacggagtccctgacagccgggac
aattgccgcttggtgcccaacccgggccaagaggacaatgaccgggatggcgtgggtgac
gcttgtcagggtgacttcgatgctgacaaggttatagacaagatcgatgtgtgccccgag
aacgccgaggtcactctcaccgacttcagggccttccaaacagttgtgctggaccccgag
ggtgatgcgcagatcgaccccaactgggtggtgctcaatcagggaatggagatcgttcag
accatgaacagtgaccctggcctggctgtgggttacacggcattcaacggtgtagatttt
gagggaacgttccatgtaaacaccgccaccgatgatgactacgctggcttcatcttcggc
tatcaagacagctcaagtttctatgtggtcatgtggaaacagatggagcagacgtactgg
caggccaatcctttccgggcagtggctgaaccagggattcagctcaaggctgtcaagtcc
tctacaggtcccggggaacagctccgaaatgcgttgtggcacacgggggacacagcatcc
caggtgcggctgctgtggaaggatcctcgaaatgtgggctggaaggataagacatcctac
cgctggttcctgcagcaccggcctcaagtcggctacatcagggtgcggttctatgagggt
cctgagctagtagctgacagcaacgtggtgctggacacagctatgcgtggtggccgcctg
ggtgtcttctgcttctcccaagagaatatcatctgggctaacctgcgctaccgttgcaat
gatacaatccctgaggactatgagcgtcaccggctgcggagggcctag

DBGET integrated database retrieval system