KEGG   Rattus norvegicus (rat): 25307Help
Entry
25307             CDS       T01003                                 

Gene name
Cst3, CYSC
Definition
(RefSeq) cystatin C
  KO
K13899  cystatin-C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    25307 (Cst3)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I25: cystatin family
   25307 (Cst3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25307 (Cst3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cystatin SQAPI
Motif
Other DBs
NCBI-GeneID: 25307
NCBI-ProteinID: NP_036969
RGD: 2432
Ensembl: ENSRNOG00000005195
UniProt: P14841
Position
3q41
AA seq 140 aa AA seqDB search
MASPLRSLMLLLAVLAVAWAGTSRPPPRLLGAPQEADASEEGVQRALDFAVSEYNKGSND
AYHSRAIQVVRARKQLVAGINYYLDVEMGRTTCTKSQTNLTNCPFHDQPHLMRKALCSFQ
IYSVPWKGTHTLTKSSCKNA
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccagcccgctgcgctccttgatgctactgctggccgtcctggccgtggcctgggcc
ggaacctccaggccacccccgcgattgttgggagctccgcaggaggcagatgccagcgag
gagggcgtgcagcgagcgttggacttcgccgtaagcgagtacaacaagggcagcaacgat
gcgtaccacagccgcgccatacaggtggtgagagctcgtaagcagcttgtggctggaata
aactattatttggatgtggagatgggccgaactacatgtaccaagtcccagacaaatttg
actaactgtcctttccacgaccagccccatctgatgaggaaggcactctgctccttccag
atctacagcgtgccctggaaaggcacacacaccctgacaaaatccagctgcaaaaatgcc
taa

DBGET integrated database retrieval system