KEGG   Rattus norvegicus (rat): 25310Help
Entry
25310             CDS       T01003                                 

Gene name
Cyct, CYCTA
Definition
(RefSeq) cytochrome c, testis
  KO
K08738  cytochrome c
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04115  p53 signaling pathway
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno05010  Alzheimer's disease
rno05012  Parkinson's disease
rno05014  Amyotrophic lateral sclerosis (ALS)
rno05016  Huntington's disease
rno05134  Legionellosis
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05167  Kaposi's sarcoma-associated herpesvirus infection
rno05168  Herpes simplex infection
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05222  Small cell lung cancer
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    25310 (Cyct)
   04215 Apoptosis - multiple species
    25310 (Cyct)
   04115 p53 signaling pathway
    25310 (Cyct)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    25310 (Cyct)
   05210 Colorectal cancer
    25310 (Cyct)
   05222 Small cell lung cancer
    25310 (Cyct)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    25310 (Cyct)
   05012 Parkinson's disease
    25310 (Cyct)
   05014 Amyotrophic lateral sclerosis (ALS)
    25310 (Cyct)
   05016 Huntington's disease
    25310 (Cyct)
  Cardiovascular diseases
   05416 Viral myocarditis
    25310 (Cyct)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    25310 (Cyct)
  Infectious diseases
   05134 Legionellosis
    25310 (Cyct)
   05152 Tuberculosis
    25310 (Cyct)
   05164 Influenza A
    25310 (Cyct)
   05161 Hepatitis B
    25310 (Cyct)
   05168 Herpes simplex infection
    25310 (Cyct)
   05163 Human cytomegalovirus infection
    25310 (Cyct)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    25310 (Cyct)
   05145 Toxoplasmosis
    25310 (Cyct)
  Drug resistance
   01524 Platinum drug resistance
    25310 (Cyct)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 25310
NCBI-ProteinID: NP_036972
RGD: 2452
Ensembl: ENSRNOG00000024457
UniProt: P10715
Position
3q24
AA seq 105 aa AA seqDB search
MGDAEAGKKIFIQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGVIW
TEETLMEYLENPKKYIPGTKMIFAGIKKKSEREDLIQYLKEATSS
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgctgaagcaggcaagaagattttcattcagaaatgtgcgcagtgccacaca
gtggagaaaggtgggaagcacaagacagggccaaatctctggggcctttttggccgaaag
actggacaagcaccaggattttcttacacggatgcaaacaagaacaaaggtgttatctgg
acagaagaaactttgatggaatatttggagaacccgaagaaatacatcccaggcactaaa
atgatttttgctggtatcaaaaagaagagtgagagagaagaccttattcaatatttaaaa
gaggcaacatcctcatga

DBGET integrated database retrieval system