KEGG   Rattus norvegicus (rat): 25316Help
Entry
25316             CDS       T01003                                 

Gene name
Ms4a2, FCIGA, Fcer1b, Ms4a1
Definition
(RefSeq) membrane spanning 4-domains A2
  KO
K08090  high affinity immunoglobulin epsilon receptor subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno05310  Asthma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    25316 (Ms4a2)
   04071 Sphingolipid signaling pathway
    25316 (Ms4a2)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    25316 (Ms4a2)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    25316 (Ms4a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25316 (Ms4a2)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   25316 (Ms4a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD20 TMEM192
Motif
Other DBs
NCBI-GeneID: 25316
NCBI-ProteinID: NP_036977
RGD: 2598
Ensembl: ENSRNOG00000020993
UniProt: P13386
Position
1q43
AA seq 243 aa AA seqDB search
MDTENKSRADLALPNPQESPSAPDIELLEASPPAKALPEKPASPPPQQTWQSFLKKELEF
LGVTQVLVGLICLCFGTVVCSTLQTSDFDDEVLLLYRAGYPFWGAVLFVLSGFLSIMSER
KNTLYLVRGSLGANIVSSIAAGLGIAILILNLSNNSAYMNYCKDITEDDGCFVTSFITEL
VLMLLFLTILAFCSAVLLIIYRIGQEFERSKVPDDRLYEELHVYSPIYSALEDTREASAP
VVS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggacacagaaaataagagcagagcagatcttgctctcccaaacccacaagaatccccc
agcgcacctgacattgaactcttggaagcgtcccctcctgcaaaagctctaccagagaag
ccagcctcacccccaccacagcagacatggcagtcatttttgaagaaagagttggagttc
ctgggcgtaacccaagttctggttggtttgatatgcctttgttttggaacagttgtctgc
tccacactccagacttcagactttgacgacgaagtgcttttattatatagagcaggctac
ccattctggggtgcagtgctgtttgttttgtctggatttttgtcaattatgtccgaaagg
aaaaacacactgtatctggtgagaggcagcctgggagcaaacattgtcagcagcatcgct
gcaggcttggggatcgccatattgattctcaatctgagcaacaactccgcttatatgaac
tactgcaaggatataaccgaagacgatggttgcttcgtgacttctttcatcacagaactg
gtgttgatgttgctgtttctcaccatcctggccttttgcagtgccgtgctgctcattatc
tataggattggacaagaatttgagcgtagtaaggtccccgatgaccgtctctatgaagaa
ttacatgtgtattcaccaatttacagtgcgttggaagacacaagggaagcgtccgcacca
gtggtttcataa

DBGET integrated database retrieval system