KEGG   Rattus norvegicus (rat): 25318
Entry
25318             CDS       T01003                                 

Gene name
Fnta, PFAS
Definition
(RefSeq) farnesyltransferase, CAAX box, alpha
  KO
K05955  protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha [EC:2.5.1.58 2.5.1.59]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00900  Terpenoid backbone biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    25318 (Fnta)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:rno01006]
    25318 (Fnta)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.58  protein farnesyltransferase
     25318 (Fnta)
    2.5.1.59  protein geranylgeranyltransferase type I
     25318 (Fnta)
Prenyltransferases [BR:rno01006]
 Protein prenylation
  Farnesyltransferase/geranylgeranyltransferase 1
   25318 (Fnta)
SSDB
Motif
Pfam: PPTA
Other DBs
NCBI-GeneID: 25318
NCBI-ProteinID: NP_036979
RGD: 2625
Ensembl: ENSRNOG00000014462
UniProt: Q04631
Structure
PDB: 

Position
16q12.4
AA seq 377 aa
MAATEGVGESAPGGEPGQPEQPPPPPPPPPAQQPQEEEMAAEAGEAAASPMDDGFLSLDS
PTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLT
RDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLK
DPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQR
HFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLL
DLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIG
RSLQSKHSRESDIPASV
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcggccactgagggggtcggggaatctgcgccaggcggtgagccgggacagccagag
cagccgccgcccccgcctcctccgccgccagcacagcagccgcaggaagaagagatggcg
gccgaggccggggaagcagcggcgtcccctatggacgacgggtttctgagcctggactcg
cccacctatgtcttgtacagggacagggcagagtgggctgacatagacccagtgccccag
aatgatggccccagtccagtggtccagatcatctacagtgaaaagtttagagacgtctat
gattacttccgagctgttctgcagcgcgatgaaagaagcgaacgagcctttaagctcact
cgagatgctattgagttaaacgcagccaactatacggtgtggcattttcggagagttctc
ttgaggtcgcttcagaaggatctgcaagaagaaatgaactacatcatcgcaataattgag
gaacagcccaaaaactatcaagtttggcaccataggagagtattagtggagtggctgaaa
gatccttctcaagagctcgagttcatcgccgatatccttaatcaggatgcaaagaattac
catgcctggcagcatcgacagtgggtcattcaggagtttcgactttgggataatgagctg
cagtatgtggaccagcttctcaaagaggatgtgagaaataactctgtgtggaaccaaaga
cacttcgtcatttctaataccactggctacagtgatcgcgctgtgttggagagagaagtc
caatatactctggaaatgatcaaattagtgccacacaatgagagtgcgtggaactacttg
aaagggattttgcaggaccgtggtctttccagataccctaatctattaaaccagttgctt
gatttacaaccaagtcacagctccccctacctaattgcctttcttgtggatatctatgaa
gacatgctggaaaaccagtgtgacaacaaggaggacattcttaataaagcactagagtta
tgtgagattctagctaaagaaaaggacactataagaaaggaatattggagatatattgga
cggtccctccagagtaaacacagcagagaaagtgacataccggcgagtgtatag

DBGET integrated database retrieval system