KEGG   Rattus norvegicus (rat): 25319
Entry
25319             CDS       T01003                                 

Gene name
Fth1, Fth
Definition
(RefSeq) ferritin heavy chain 1
  KO
K00522  ferritin heavy chain [EC:1.16.3.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04216  Ferroptosis
rno04217  Necroptosis
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    25319 (Fth1)
   04217 Necroptosis
    25319 (Fth1)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    25319 (Fth1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25319 (Fth1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.3  With oxygen as acceptor
    1.16.3.2  bacterial non-heme ferritin
     25319 (Fth1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25319 (Fth1)
  Exosomal proteins of bladder cancer cells
   25319 (Fth1)
SSDB
Motif
Pfam: Ferritin Rubrerythrin
Other DBs
NCBI-GeneID: 25319
NCBI-ProteinID: NP_036980
RGD: 2635
Ensembl: ENSRNOG00000022619
UniProt: P19132 Q66HI5
Position
1q43
AA seq 182 aa
MTTASPSQVRQNYHQDSEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQS
HEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHK
LATDKNDPHLCDFIETHYLNEQVKSIKELGDHVTNLRKMGAPESGMAEYLFDKHTLGHGD
ES
NT seq 549 nt   +upstreamnt  +downstreamnt
atgaccaccgcgtctccctcgcaagtgcgccagaactaccaccaggactcggaggctgcc
atcaaccgccagatcaacctggagttgtatgcctcctacgtctatctgtccatgtcttgt
tattttgaccgggatgatgtggccctgaagaactttgccaaatactttctccatcaatct
catgaagagagggaacatgctgagaaactgatgaagctgcagaaccagcgaggtggacga
atcttcctgcaggatataaagaaacctgaccgtgatgactgggagagcgggctgaatgca
atggagtgtgcactgcacttggaaaagagtgtgaatcagtcactactggaacttcacaaa
ctggctactgacaagaatgatccccacttatgtgacttcattgagacgcattacctgaat
gagcaggtgaaatccattaaagaactgggtgaccacgtgaccaacttacgcaagatggga
gcccctgaatctggcatggcagaatatctctttgacaagcacaccctgggacacggtgat
gagagctaa

DBGET integrated database retrieval system