KEGG   Rattus norvegicus (rat): 25321Help
Entry
25321             CDS       T01003                                 

Gene name
Ghrhr, GHRHREC
Definition
(RefSeq) growth hormone releasing hormone receptor
  KO
K04584  growth hormone releasing hormone receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25321 (Ghrhr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25321 (Ghrhr)
G protein-coupled receptors [BR:rno04030]
 Secretin receptor family
  Hypothalamic hormone
   Growth hormone-releasing hormone (GHRH)
    25321 (Ghrhr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM Dicty_CAR
Motif
Other DBs
NCBI-GeneID: 25321
NCBI-ProteinID: NP_036982
RGD: 2688
Ensembl: ENSRNOG00000011808
UniProt: Q02644
Position
4q24
AA seq 423 aa AA seqDB search
MDSLLWATWVLCLLNLWGVALGHLHLECDFITQLRDDELACLQAAEGTNNSSMGCPGTWD
GLLCWPPTGSGQWVSLPCPEFFSHFGSDPGAVKRDCTITGWSDPFPPYPVACPVPLELLT
EEKSYFSTVKIIYTTGHSISIVALCVAIAILVALRRLHCPRNYIHTQLFATFILKASAVF
LKDAAVFQGDSTDHCSMSTILCKVSVAVSHFATMTNFSWLLAEAVYLSCLLASTSPRSKP
AFWWLVLAGWGLPVLCTGTWVGCKLAFEDTACWDLDDSSPYWWIIKGPIVLSVGVNFGLF
LNIICILLRKLGPAQGGLHTRAQYWRLSKSTLLLIPLFGIHYIIFNFLPDSAGLGIRLPL
ELGLGSFQGFVVAVLYCFLNQEVRTEISRKWYGHDPELLPARRTCTEWTTPPRSRVKVLT
SEC
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggacagcctgttgtgggctacctgggtcctctgcttgctgaacctgtggggagttgca
ctgggtcacctccacctagaatgtgacttcatcactcagctgagagacgatgagcttgca
tgccttcaggcggcagaggggaccaacaactcgtccatgggatgccctgggacctgggat
gggctgctgtgctggcccccaactggctctggccagtgggtctccctcccctgccctgaa
ttcttctctcattttggctcagacccaggggctgtgaaaagggactgcaccatcacgggt
tggtctgatcccttcccaccatatcccgtggcctgtcctgtgcccttggaactgctaaca
gaggagaagtcttacttctccacggtgaagatcatctacaccacaggccacagcatctcc
attgtagccctctgcgtggctattgccatcctggttgctctcaggaggctccactgcccc
aggaactacatccacacgcagctgtttgctactttcatcctcaaggccagtgctgtgttc
ctgaaggatgctgctgtcttccagggtgatagcacggaccactgcagcatgtccactatt
ctgtgcaaggtctctgtggccgtctcacattttgccaccatgaccaacttcagctggctg
ctggcagaagccgtctacctgagctgtctgttggcctccacatctcctaggtccaaacca
gctttctggtggctggttctcgctggctggggactccctgtgctatgcactggtacgtgg
gtgggctgcaaactggcttttgaggacactgcgtgctgggacctagacgacagctccccc
tactggtggatcatcaaagggcccatagtcctctctgttggggtgaactttgggctgttt
ctcaatataatttgcatcctgctgaggaagctggggcctgcacaaggcggcttacacaca
cgggctcagtactggcggctttccaaatcaacacttctccttatcccgctgtttggaatt
cattacatcatcttcaacttcctgcctgacagtgctggccttggcatccgtctacccctg
gagctgggactggggtccttccagggttttgttgttgctgtcctctactgcttcctcaat
caagaggtgaggacggagatttcacgcaaatggtatggccatgaccctgaacttctgcca
gctcggcggacctgcactgagtggaccacacctccccgatcgagagtgaaggtgctcacc
tctgagtgctag

DBGET integrated database retrieval system