KEGG   Rattus norvegicus (rat): 25323Help
Entry
25323             CDS       T01003                                 

Gene name
Htr1d, 5HT1D
Definition
(RefSeq) 5-hydroxytryptamine receptor 1D
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04726  Serotonergic synapse
rno04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    25323 (Htr1d)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25323 (Htr1d)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    25323 (Htr1d)
  09157 Sensory system
   04742 Taste transduction
    25323 (Htr1d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25323 (Htr1d)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    25323 (Htr1d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 25323
NCBI-ProteinID: NP_036984
RGD: 2847
Ensembl: ENSRNOG00000012038
UniProt: P28565
Position
5q36
AA seq 374 aa AA seqDB search
MSLPNQSLEGLPQEASNRSLNATGAWDPEVLQALRISLVVVLSIITLATVLSNAFVLTTI
LLTKKLHTPANYLIGSLATTDLLVSILVMPISIAYTTTRTWNFGQILCDIWVSSDITCCT
ASILHLCVIALDRYWAITDALEYSKRRTAGHAAAMIAAVWAISICISIPPLFWRQATAHE
EMSDCLVNTSQISYTIYSTCGAFYIPSILLIILYGRIYVAARSRILNPPSLYGKRFTTAQ
LITGSAGSSLCSLNPSLHESHTHTVGSPLFFNQVKIKLADSILERKRISAARERKATKTL
GIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPVIYTVFNEDF
RQAFQRVVHFRKAS
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgccaaaccagtccctagaaggccttcctcaggaggcctccaacagatccctg
aatgctacaggggcttgggacccagaggtcctgcaggcactcagaatctccctcgtggtg
gtcctatccatcattacactggccactgtcctctccaatgccttcgtacttaccaccatc
ctgctcaccaagaagctccataccccagccaactatctcattggctccttggccaccacc
gacctcctggtttctatcttggtcatgcccatcagcatagcctataccaccacccgtacc
tggaactttggccagatcctgtgtgacatctgggtgtcttctgacatcacatgctgtacg
gcctccatcctgcatctctgtgtcatcgctctggacagatactgggccatcaccgatgcc
ctggagtacagcaagcgccggaccgcaggtcacgcggcggccatgattgcggccgtctgg
gccatctccatctgtatctccatcccaccgctcttctggcggcaggccacggctcacgag
gagatgtctgactgcctggtgaacacatctcagatttcttacaccatctactcgacctgt
ggggccttctacatcccatccatcttgctcattatcctgtatggccgcatatacgtggcc
gcccggagtcgaatcctgaacccaccctccctctacgggaagcgcttcaccacagcacag
cttatcacgggctctgcgggctcttcactctgctcgctcaaccccagcctccacgagagc
cacacgcacacagtcggttcccctctttttttcaaccaggtgaaaatcaagcttgctgat
agcatcttagaacgcaagaggatctctgcagcccgagaaaggaaagccactaagacattg
ggcatcattctgggggcctttatcatctgctggctgcctttctttgtggtatccttggtc
ctccccatctgcagggactcctgttggatccacccggccctctttgacttcttcacgtgg
ctaggttatttaaactctctcattaaccccgtcatctacactgtgttcaacgaagacttt
cgacaagcgtttcagagagtcgtccatttccgaaaggcctcttag

DBGET integrated database retrieval system