KEGG   Rattus norvegicus (rat): 25324
Entry
25324             CDS       T01003                                 

Gene name
Htr4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    25324 (Htr4)
   04024 cAMP signaling pathway
    25324 (Htr4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25324 (Htr4)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    25324 (Htr4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25324 (Htr4)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    25324 (Htr4)
SSDB
Motif
Pfam: 7tm_1 DUF5133 zf-LITAF-like
Other DBs
NCBI-GeneID: 25324
NCBI-ProteinID: NP_036985
RGD: 2850
Ensembl: ENSRNOG00000019134
UniProt: Q62758
Position
18q12.1
AA seq 406 aa
MDRLDANVSSNEGFGSVEKVVLLTFFAMVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLVNAFGAIELVQDIWFYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIVDVIEKRKFNHNSN
STFCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGATSESRP
QTADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIVDPFIDYTVPEKVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPILGQTVPCSTTTINGSTHVLRD
TVECGGQWESRCHLTATSPLVAAQPVIRRPQDNDLEDSCSLKRSQS
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggacagacttgatgctaatgtgagttccaacgagggtttcgggtctgtggagaaggtc
gtactgctcacgttcttcgcaatggttatcctgatggccatcctgggcaacctgctggtg
atggttgctgtgtgcagggacaggcagctcaggaaaataaaaaccaattatttcattgtg
tctcttgcctttgctgatctgctggtttcggtgctggtgaatgccttcggtgccattgag
ttggtccaagacatctggttttatggggagatgttttgcctggtccggacctctctggat
gtcctactcaccacagcatcaatttttcacctctgctgcatttccctggataggtattat
gccatctgctgtcaacctttggtttatagaaacaagatgacccctctacgcatcgcatta
atgctgggaggctgctgggtcattcccatgtttatatcttttctccccataatgcaaggc
tggaacaacatcggcatagttgatgtgatagagaaaaggaaattcaaccacaactctaac
tctacattctgtgtcttcatggtcaacaagccctatgccatcacctgctctgtggtggcc
ttctacatcccgtttctcctcatggtgctggcctattaccgtatctatgtcactgctaag
gagcatgcccagcagatccagatgttacaacgggcaggagccacctctgaaagcaggccc
cagacagctgaccagcacagcacacatcgcatgcggacagagaccaaagcagccaagact
ttatgtgtcatcatgggctgcttctgtttctgctgggcccccttctttgtcaccaatatt
gtggaccctttcatagactacactgtgcccgagaaggtgtggactgctttcctctggctt
ggctatatcaattcagggttgaacccttttctctatgccttcttgaataagtctttcaga
cgtgccttccttatcatcctctgctgtgatgatgagcgctacaaaagaccccccattctg
ggccagactgtcccctgttcaaccacaaccattaatggatccactcatgtgctaagggat
acagtggaatgtggtggccaatgggagagtcggtgtcacctcacagcaacttctcctttg
gtggctgctcagccagtgatacgtaggccccaggacaatgacctagaagacagctgtagc
ttgaaaagaagccagtcctaa

DBGET integrated database retrieval system