KEGG   Rattus norvegicus (rat): 25325
Entry
25325             CDS       T01003                                 

Gene name
Il10
Definition
(RefSeq) interleukin-10 precursor
  KO
K05443  interleukin 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04068  FoxO signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04630  JAK-STAT signaling pathway
rno04660  T cell receptor signaling pathway
rno04672  Intestinal immune network for IgA production
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05143  African trypanosomiasis
rno05144  Malaria
rno05145  Toxoplasmosis
rno05146  Amoebiasis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05310  Asthma
rno05320  Autoimmune thyroid disease
rno05321  Inflammatory bowel disease
rno05322  Systemic lupus erythematosus
rno05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    25325 (Il10)
   04068 FoxO signaling pathway
    25325 (Il10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25325 (Il10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    25325 (Il10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    25325 (Il10)
   04660 T cell receptor signaling pathway
    25325 (Il10)
   04672 Intestinal immune network for IgA production
    25325 (Il10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    25325 (Il10)
   05133 Pertussis
    25325 (Il10)
   05150 Staphylococcus aureus infection
    25325 (Il10)
   05152 Tuberculosis
    25325 (Il10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    25325 (Il10)
   05144 Malaria
    25325 (Il10)
   05145 Toxoplasmosis
    25325 (Il10)
   05140 Leishmaniasis
    25325 (Il10)
   05142 Chagas disease
    25325 (Il10)
   05143 African trypanosomiasis
    25325 (Il10)
  09163 Immune disease
   05310 Asthma
    25325 (Il10)
   05322 Systemic lupus erythematosus
    25325 (Il10)
   05320 Autoimmune thyroid disease
    25325 (Il10)
   05321 Inflammatory bowel disease
    25325 (Il10)
   05330 Allograft rejection
    25325 (Il10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    25325 (Il10)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25325 (Il10)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   25325 (Il10)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Cytokines
   25325 (Il10)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 25325
NCBI-ProteinID: NP_036986
RGD: 2886
Ensembl: ENSRNOG00000004647
UniProt: P29456
Position
13
AA seq 178 aa
MPGSALLCCLLLLAGVKTSKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQ
LDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLW
IQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcctggctcagcactgctatgttgcctgctcttactggctggagtgaagaccagcaaa
ggccattccatccggggtgacaataactgcacccacttcccagtcagccagacccacatg
ctccgagagctgagggctgccttcagtcaagtgaagactttctttcaaaagaaggaccag
ctggacaacatactgctgacagattccttactgcaggactttaagggttacttgggttgc
caagccttgtcagaaatgatcaagttttacctggtagaagtgatgccccaggcagagaac
catggcccagaaatcaaggagcatttgaattccctgggagagaagctgaagaccctctgg
atacagctgcgacgctgtcatcgatttctcccctgtgagaataaaagcaaggcagtggag
caggtgaagaatgattttaataagctccaagacaaaggtgtctacaaggccatgaatgag
tttgacatcttcatcaactgcatagaagcctacgtgacactcaaaatgaaaaattga

DBGET integrated database retrieval system