KEGG   Rattus norvegicus (rat): 25326Help
Entry
25326             CDS       T01003                                 

Gene name
Jak3, RATJAK3
Definition
(RefSeq) Janus kinase 3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04630  Jak-STAT signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno05161  Hepatitis B
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05223  Non-small cell lung cancer
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    25326 (Jak3)
   04151 PI3K-Akt signaling pathway
    25326 (Jak3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    25326 (Jak3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    25326 (Jak3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    25326 (Jak3)
   04659 Th17 cell differentiation
    25326 (Jak3)
   04062 Chemokine signaling pathway
    25326 (Jak3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25326 (Jak3)
   05203 Viral carcinogenesis
    25326 (Jak3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    25326 (Jak3)
  09163 Immune disease
   05340 Primary immunodeficiency
    25326 (Jak3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25326 (Jak3)
   05162 Measles
    25326 (Jak3)
   05161 Hepatitis B
    25326 (Jak3)
   05169 Epstein-Barr virus infection
    25326 (Jak3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25326 (Jak3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     25326 (Jak3)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   25326 (Jak3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase FERM_F2 FERM_F1 Jak1_Phl APH pKID Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 25326
NCBI-ProteinID: NP_036987
RGD: 2940
Ensembl: ENSRNOG00000018669
UniProt: F1LR79
Position
16p14
AA seq 1100 aa AA seqDB search
MAPPSEETPLISQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSFGDYLAEDLCVRAAKA
CGILPVYHSLFALATEDLSCWFPPSHIFSIEDVDTQVLVYRLRFYFPGWFGLETCHRFGL
HKDLTSAILDVHVLEHLFAQHRSDLVSGRLPVGLSLKDQGEFLSLAVLDLAQMARKQAQR
PGELLKSVSYKACLPPSLRDLIQGQSFVTRRRIRRTVVQALRRVVACQADRYALMAKYIL
DLERLHPAATTESFLVGLPGAQEEPGCLRVTGDNGIAWSSKDQELFQTFCDFPEIVDVSI
KQAPRVGPAGEHRLVTITRMDGHILEAEFPGLPEALSFVALVDGYFRLICDSRHFFCKEV
APPRLLEEEAELCHGPITLDFAIHKLKAAGSLPGSYILRRSPQDYDSFLLTACVQTPLGP
DYKGCLIRQDPSGAFSLVGLSQLHRSLQELLTACWHSGLQVDGTALNLTSCCVPRPKEKS
NLIVVRRGRNPTPAPGHSPSCCALTKLSFHTIPADSLEWHENLGHGSFTKIFHGHRREVV
DGETHDTEVLLKVMDSRHQNCMESFLEAASLMSQVSYPHLVLLHGVCMAGDSIMVQEFVY
LGAIDTYLRKRGHLVPASWKLQVTKQLAYALNYLEDKGLPHGNVSARKVLLAREGVDGNP
PFIKLSDPGVSPTVLSLEMLTDRIPWVAPECLQEAGTLNLEADKWGFGATTWEVFSGAPM
HITSLEPAKKLKFYEDRGQLPALKWTELEGLIAQCMAYDPGRRPSFRAILRDLNGLITSD
YELLSDPTPGIPNPRDELCGGAQLYACQDPAIFEERHLKYISLLGKGNFGSVELCRYDPL
GDNTGPLVAVKQLQHSGPEQQRDFQREIQILKALHCDFIVKYRGVSYGPGRQSLRLVMEY
LPSGCLRDFLQRHRARLHNDRLLLFAWQICKGMEYLGARRCVHRDLAARNILVESEAHVK
IADFGLAKLLPLGKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYS
DKSCSPSTEFLRMMGPEREGSPLCHLLELLAEGRRLPPPSTCPTEVQELMQLCWSPNPQD
RPAFDTLSPQLDALWRGSPG
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atggcacctccaagcgaggagacacctctcatctctcagcgctcttgtagcctctcatcc
tcagaagcaggagccctgcatgtgctccttcctccccggggacctgggcctccccagcga
ctgtcattctcttttggggactacttggctgaggacctgtgtgtgcgggctgccaaggcc
tgtggcatcctgcccgtttatcattcgctcttcgctctggccaccgaggacttgtcttgc
tggttccccccaagccacatcttctccatagaggacgtggacactcaagtcttggtctac
aggctacgcttttattttcctggttggtttggactggagacctgtcaccgctttgggtta
cacaaagatttgaccagtgccatccttgacgtacatgttttagaacacctctttgcccag
caccgcagtgacctggtgagtgggcgtctcccagtaggccttagcctgaaggaccaggga
gagttcctgagcctagctgtgctggacctggcccagatggctcgtaagcaggcccagcgg
ccaggagagctgctgaagtccgtcagttacaaagcctgtctgccgcccagcctgcgcgac
ctgatccagggccagagcttcgtgacgcgcaggcgcatccgcaggaccgtggtccaggcg
ctgcgccgtgtagtagcctgccaagccgaccgctacgcactcatggccaagtacatccta
gaccttgagcggctgcatccagcggccaccactgagtccttcctcgtgggactcccgggc
gcccaggaggagccgggttgcctgcgtgtgacaggggataatggcatcgcctggagctcc
aaggaccaggagcttttccagaccttctgtgactttccagaaatcgtggatgtcagcatc
aagcaggctccacgcgtgggtccggcaggggagcaccggctagtcaccatcaccaggatg
gacggtcacatcctggaagcggagttcccggggctgcctgaggcgctgtctttcgtggcg
ctcgtggatgggtactttcgcctgatctgcgactccaggcatttcttctgcaaggaggtg
gcaccgccacggctgctggaggaagaggcggagctgtgccatggacccatcacgttagac
tttgccatccacaagctgaaggctgctggctccctcccgggctcctacattctccgacgc
agcccgcaggactatgacagctttcttcttactgcctgtgtccagactcctcttggcccc
gactacaagggctgcctcatccgccaagaccccagtggggctttctccctggttggtctc
agccagctgcacagaagcctacaggagctgctcacagcctgctggcattctggactgcaa
gtagacggcactgccctgaacctcacatcttgctgcgtccccagacccaaggaaaagtcc
aatttgatcgtggtgcgtaggggccgcaaccccacgcctgcccccgggcactccccatcc
tgctgtgcgctgactaagttgagcttccacacaatcccagcagacagcctggagtggcac
gagaatcttggtcacggctcttttaccaagatcttccatggccataggcgggaggttgtg
gatggtgagacacatgacacagaagtcctcctgaaggttatggactccagacaccagaac
tgcatggagtcctttctggaagccgcaagcttgatgagccaagtatcctacccgcacctg
gtgttgctgcatggagtctgcatggctggagacagcatcatggtgcaggaatttgtgtac
cttggagcaattgacacgtacctgcgcaagcgtggtcacctggtgccggccagctggaaa
ctgcaggtgaccaagcagctggcctatgcccttaactacttggaggacaaaggcctccct
catggcaacgtctcagcgaggaaggtgctgctagctcgtgagggggttgatgggaatcca
cctttcatcaagctgagtgatcctggtgtcagcccaactgttttgagcctggaaatgctc
actgacaggattccctgggtggccccggagtgtctccaggaagctggaacgctcaacttg
gaggctgacaagtggggctttggcgccaccacgtgggaggtgttcagcggggcacccatg
cacattacctcgctggagcccgccaagaagctgaagttctatgaggaccggggacagctg
ccggccctcaaatggacagagctggaggggctcatcgcacagtgcatggcgtatgatcct
ggccggcgcccctccttccgagccatcctcagagacctcaacggcctcattacatcagat
tacgagctcctctcagaccccacacctggcatcccgaatccccgagatgagctgtgtggt
ggtgcccagctctatgcctgccaggaccccgccatcttcgaggagagacaccttaagtac
atctccctgctgggcaaggggaacttcggcagcgtggagctgtgccgctacgaccctctg
ggagacaatacgggacccctggtagcagtgaagcagttacagcacagcgggccagaacag
cagagggacttccagcgagagattcagatcctcaaggctctacactgtgacttcatcgtc
aagtaccggggagtcagctatgggcctggtcgccagagcctgcggttagtgatggagtac
ctgcccagcggctgcctgcgggacttcctgcagcgccaccgcgcgcgcctgcacaacgac
cgcctactgctgttcgcctggcagatctgcaagggcatggagtacctgggcgcacgccgc
tgcgtgcatcgtgacctggctgcgcgcaacatcctggtggagagtgaggcgcatgtgaag
attgctgacttcggcctcgctaagctgctgcctctcggaaaagactactacgtggtccgc
gagccgggccaaagtcccatcttctggtacgcccctgagtccctatctgacaacatcttc
tcccgccaatctgacgtgtggagcttcggcgtggtgctgtatgagctcttcacctacagc
gacaagagctgcagcccatccactgagttcctgcgcatgatggggcctgagcgtgaggga
tccccgctctgccacctcttggagctgctggcagagggccgccgtctcccaccaccctcc
acctgccctactgaggttcaagagctcatgcagctgtgctggtcgcccaacccacaagac
cggccagcatttgacaccctgagcccccagctggatgcgctgtggcgcggaagccccgga
tag

DBGET integrated database retrieval system