KEGG   Rattus norvegicus (rat): 25329
Entry
25329             CDS       T01003                                 

Gene name
Lhb
Definition
(RefSeq) lutropin subunit beta isoform 1 precursor
  KO
K08521  lutropin subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04917  Prolactin signaling pathway
rno04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    25329 (Lhb)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25329 (Lhb)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    25329 (Lhb)
   04912 GnRH signaling pathway
    25329 (Lhb)
   04913 Ovarian steroidogenesis
    25329 (Lhb)
   04917 Prolactin signaling pathway
    25329 (Lhb)
SSDB
Motif
Pfam: Cys_knot
Other DBs
NCBI-GeneID: 25329
NCBI-ProteinID: NP_036990
RGD: 3006
Ensembl: ENSRNOG00000047040
UniProt: P01230 A0A0A0MY50
Position
1
AA seq 141 aa
MERLQGLLLWLLLSPSVVWASRGPLRPLCRPVNATLAAENEFCPVCITFTTSICAGYCPS
MVRVLPAALPPVPQPVCTYRELRFASVRLPGCPPGVDPIVSFPVALSCRCGPCRLSSSDC
GGPRTQPMTCDLPHLPGLLLF
NT seq 426 nt   +upstreamnt  +downstreamnt
atggagaggctccaggggctgctgctgtggctgctgctgagcccaagtgtggtgtgggcc
tccaggggcccccttcggccactgtgccggcctgtcaacgcaaccctggctgcagagaat
gagttctgcccagtctgcatcaccttcaccaccagcatctgtgccggctactgtcctagc
atggttcgagtactgccagctgccttgcctcccgtgcctcagccagtgtgcacctaccgt
gagctgcgcttcgcctctgtccgcctccctggctgcccacctggtgtagaccccatagtc
tcctttcctgtggccctcagctgccgctgtgggccctgccgtctcagtagctctgactgt
gggggtcccaggactcaaccaatgacctgtgaccttccccacctccccggccttctcctc
ttctga

DBGET integrated database retrieval system