KEGG   Rattus norvegicus (rat): 25331Help
Entry
25331             CDS       T01003                                 

Gene name
Mat1a, AdoMet, SADE, SAS
Definition
(RefSeq) methionine adenosyltransferase 1A
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00270  Cysteine and methionine metabolism
rno01100  Metabolic pathways
rno01230  Biosynthesis of amino acids
Module
rno_M00034  Methionine salvage pathway
rno_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    25331 (Mat1a)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     25331 (Mat1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N AdoMet_Synthase
Motif
Other DBs
NCBI-GeneID: 25331
NCBI-ProteinID: NP_036992
RGD: 3050
Ensembl: ENSRNOG00000011351
UniProt: P13444
Structure
PDB: 

Position
16p14
AA seq 396 aa AA seqDB search
MNGPVDGLCDHSLSEEGAFMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETV
CKTGMVLLCGEITSMAMIDYQRVVRDTIKHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQ
CVHLDRNEEDVGAGDQGLMFGYATDETEECMPLTIVLAHKLNTRMADLRRSGVLPWLRPD
SKTQVTVQYVQDNGAVIPVRVHTIVISVQHNEDITLEAMREALKEQVIKAVVPAKYLDED
TIYHLQPSGRFVIGGPQGDAGVTGRKIIVDTYGGWGAHGGGAFSGKDYTKVDRSAAYAAR
WVAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSKKTERELLEVVNKNFDLRPGV
IVRDLDLKKPIYQKTACYGHFGRSEFPWEVPKKLVF
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatggacctgtggatggcttgtgtgaccattctctaagtgaagagggagccttcatg
ttcacatctgaatcggtaggagaagggcatccagataagatctgtgaccagattagtgat
gcagtgctggatgcccatctcaagcaagaccccaatgccaaggtggcctgtgagacagtg
tgcaagacagggatggtgctcctgtgtggagagatcacctcaatggccatgattgactac
cagcgggtggtgagagacaccattaagcacattggctacgatgactctgccaagggcttc
gacttcaagacctgcaatgtgctcgtggctctggagcaacagtccccagacattgcccaa
tgtgtccatctagacagaaatgaggaggacgttggtgcaggagatcagggtctgatgttc
ggctatgccactgacgagacagaggagtgcatgccgctcaccattgttcttgctcacaaa
ctcaacacccggatggcagatctgaggcgctctggtgtccttccctggctgagacctgat
tctaagactcaggtaacagttcagtacgtgcaggataatggtgctgtcatccctgttcgc
gtccacaccatcgtcatctctgtgcaacacaacgaagacataacactggaggccatgcga
gaggccctgaaggagcaggtgatcaaagctgtggtgccagccaagtacctggatgaagac
accatctaccacctgcagccaagtgggcggtttgtcatcggaggtccccagggggatgca
ggtgtcacaggccgcaagattattgtggacacatacggaggctggggtgcccatggtggt
ggtgccttctctggaaaggactacaccaaggtggaccgctcagcagcttatgccgcccgc
tgggtggccaagtctctggtgaaggctgggctctgccggagagtccttgttcaggtgtcc
tatgccattggtgtggcagaacctctgtccatttccattttcacctacggaacttccaag
aagaccgagcgagagctactagaggttgtgaacaagaactttgatctccggccgggtgtt
attgtcagggacttggatctgaagaagcccatctaccagaagactgcatgctatggtcat
ttcggaagaagcgagtttccctgggaggtccccaagaagcttgtgttttag

DBGET integrated database retrieval system