KEGG   Rattus norvegicus (rat): 25332
Entry
25332             CDS       T01003                                 

Gene name
Mgmt
Definition
(RefSeq) methylated-DNA--protein-cysteine methyltransferase
  KO
K00567  methylated-DNA-[protein]-cysteine S-methyltransferase [EC:2.1.1.63]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    25332 (Mgmt)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.63  methylated-DNA---[protein]-cysteine S-methyltransferase
     25332 (Mgmt)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    25332 (Mgmt)
 Prokaryotic type
    25332 (Mgmt)
SSDB
Motif
Pfam: DNA_binding_1 Methyltransf_1N
Other DBs
NCBI-GeneID: 25332
NCBI-ProteinID: NP_036993
RGD: 3087
Ensembl: ENSRNOG00000016038
UniProt: P24528
Position
1
AA seq 209 aa
MAEICKMKYTVLDSPLGKIELSGCERGLHGIRFLSGKTPNTDPTEAPACPEVLGGPEGVP
EPLVQCTAWLEAYFHEPAATEGLPLPALHHPVFQQDSFTRQVLWKLLKVVKFGEMVSYQQ
LAALAGNPKAARAVGGAMRSNPVPILIPCHRVIRSDGAIGNYSGGGQTVKEWLLAHEGIP
TGQPASKGLGLIGSWLKPSFESSSPKPSG
NT seq 630 nt   +upstreamnt  +downstreamnt
atggctgagatctgcaaaatgaaatacacggtgttggacagccctttggggaagatagag
ctgtccggctgtgagcgaggcctgcatgggatacgatttctcagtgggaagaccccaaac
actgaccccacagaggctccagcctgtcctgaggtgctcggtgggccagagggagtgcca
gagcccctggtgcagtgcacagcctggctggaagcctatttccacgaacctgcagccaca
gaggggcttcccttgcctgctctccatcaccctgtgttccagcaagattcattcaccaga
caggtgttatggaagctgctgaaggttgtgaaattcggagaaatggtttcttaccagcaa
ttagcagccctggcaggcaaccccaaagcggctcgtgcagtaggaggagcgatgaggagc
aatccagtccccatcctcatcccctgccacagggtgattcgcagtgacggtgccattggc
aattactctggaggaggacagactgtgaaagagtggcttctggcccatgagggcatccca
actggacagccggcctccaaaggcttgggtctgattgggagctggctcaagccatccttc
gagtcttccagcccaaagccgtctggctga

DBGET integrated database retrieval system