KEGG   Rattus norvegicus (rat): 25334Help
Entry
25334             CDS       T01003                                 

Gene name
Bhlha15, Bhlhb8, Mist1, bHlH
Definition
(RefSeq) basic helix-loop-helix family, member a15
  KO
K08040  class B basic helix-loop-helix protein 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    25334 (Bhlha15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25334 (Bhlha15)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    25334 (Bhlha15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH OrfB_IS605
Motif
Other DBs
NCBI-GeneID: 25334
NCBI-ProteinID: NP_036995
RGD: 3091
Ensembl: ENSRNOG00000025164
Vega: OTTRNOG00000001889
UniProt: P70562
Position
12p11
AA seq 197 aa AA seqDB search
MKTKNRPPRRRTPMQDAEATPGEQTPDRSQSGSGASEVTKGLRSRTARASGTRAEVSRRR
QGSSSRRENSVQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNY
IKSLTATILTMSSSRLPGLEAPGPAPGPKLYQHYHHQQQQQQQQQQVAGAVLGVTEDQPQ
GHLQRYSTQIHSFREGS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaagaaccggccccctcggcgccggacacccatgcaggacgcagaagccacc
ccaggagagcagacgcctgacagatcccagtcaggctcaggggcatcagaagtgaccaag
ggtcttcggagcaggacagcccgtgcgagcggaactcgggcagaggtcagccgccggcga
caggggtccagcagccgcagggagaacagcgttcagaggcggctggagagcaatgagcga
gaaagacaacggatgcacaaactgaacaatgctttccaggcgctgcgggaggtcatcccg
catgtgcgggctgacaagaagctctccaagatcgagaccctcacactggccaagaactat
atcaagtcgctgacagccaccatacttactatgtccagcagccgcctcccggggctggag
gcgccaggtcctgcgccaggccctaaattgtaccagcattaccatcaccagcagcagcaa
cagcagcagcagcagcaggtggctggggccgtgctcggtgtcaccgaggaccagcctcaa
ggccacctgcaacgatactctacacagatccacagcttcagagaggggagctag

DBGET integrated database retrieval system