KEGG   Rattus norvegicus (rat): 25336
Entry
25336             CDS       T01003                                 

Gene name
Nfyb
Definition
(RefSeq) nuclear transcription factor Y subunit beta
  KO
K08065  nuclear transcription Y subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04612  Antigen processing and presentation
rno05152  Tuberculosis
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    25336 (Nfyb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25336 (Nfyb)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    25336 (Nfyb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25336 (Nfyb)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    25336 (Nfyb)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone TFIID-18kDa CENP-T_C TFIID_20kDa PAN_3
Other DBs
NCBI-GeneID: 25336
NCBI-ProteinID: NP_113741
RGD: 3172
Ensembl: ENSRNOG00000010309
UniProt: P63140
Position
7
AA seq 207 aa
MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLP
IANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILF
AMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVSATDGLSEELTEEAFTNQLPAGLIT
ADGQQQNVMVYTTSYQQISGVQQIQFS
NT seq 624 nt   +upstreamnt  +downstreamnt
atgacaatggatggcgacagctctacaacagatgcttctcaactagggatttctgcagac
tacatcggaggaagtcattatgtgatccagccccacgatgatactgaggacagcatgaat
gatcatgaagatacaaatggttcaaaagaaagtttcagagaacaagatatttatcttccc
attgcaaatgtggctaggataatgaaaaatgccatacctcaaacaggaaagattgcaaag
gatgccaaagaatgcgttcaggagtgtgtgagtgagtttataagcttcataacatctgaa
gcaagtgagcgctgtcaccaggagaagcggaagaccatcaacggggaggacattctgttc
gccatgtccactctcggcttcgacagctacgtggagcctctgaaactgtacctccagaag
ttcagagaggccatgaagggagagaagggcattggtggggccgtgtctgctacagatgga
ctcagcgaggagctcacggaagaggcattcactaaccagttaccggctgggttaataact
gcagatggccaacaacaaaacgttatggtttacacgacgtcctatcaacagatttctggt
gtccagcagattcagttttcatga

KEGG   Rattus norvegicus (rat): 25337
Entry
25337             CDS       T01003                                 

Gene name
Nfyc
Definition
(RefSeq) nuclear transcription factor Y subunit gamma
  KO
K08066  nuclear transcription factor Y, gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04612  Antigen processing and presentation
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    25337 (Nfyc)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    25337 (Nfyc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25337 (Nfyc)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    25337 (Nfyc)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF CENP-X
Other DBs
NCBI-GeneID: 25337
NCBI-ProteinID: NP_036998
RGD: 3173
Ensembl: ENSRNOG00000010735
UniProt: Q62725
Position
5
AA seq 335 aa
MSTEGGFGSTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKM
ISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR
DELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIII
AQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIP
VQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQ
IQQVTMPAGQDLAQPMFIQSANQPSDGQTPQVTGD
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgtccacagaaggagggtttggcagtaccagcagcagtgatgcccagcaaagcctccag
tccttctggcccagagtcatggaagaaatccgaaacttaacagtgaaagatttccgagta
caagaactaccactggctcgtattaagaagattatgaaactggatgaagatgtgaagatg
atcagtgcagaagcccctgtgctgtttgctaaggcagcccagatcttcatcacagagctg
actcttcgagcctggatccacacagaggataacaagcgtcgtactcttcagaggaatgat
attgctatggcaattacaaaatttgatcagtttgactttctcatcgacattgttccaaga
gatgaactgaaacctccaaagcgccaggaggaggtacgccagtctgtgactcccgcggag
cctgtccagtactacttcacgctggctcagcagcccactgctgtccaggtccagggacag
cagcaaggccagcagaccaccagttctacgaccaccatccagcctggccagatcatcatt
gcgcagcctcaacagggtcagaccacacccgtgaccatgcaggttggagaaggtcagcag
gtgcagattgtgcaggcccaacctcagggtcaggcccagcaggcccagagtggtactgga
cagaccatgcaggtgatgcagcagatcattaccaacacaggagagatccaacagatcccg
gtgcagctgaatgccggccagttgcagtatatccgcttagcccagcctgtatcaggcacc
caagttgtgcagggacagatccagacccttgctaccaatgcccaacagatcacacagaca
gaggtccaacaaggacagcagcagttcagccagttcacagacggacagcagctgtaccag
atccagcaagtcaccatgcctgcaggccaagaccttgcccagcccatgtttattcagtca
gccaaccagccctctgatgggcagaccccccaggtgactggagactga

KEGG   Rattus norvegicus (rat): 29508
Entry
29508             CDS       T01003                                 

Gene name
Nfya
Definition
(RefSeq) nuclear transcription factor Y subunit alpha
  KO
K08064  nuclear transcription factor Y, alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04612  Antigen processing and presentation
rno05017  Spinocerebellar ataxia
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    29508 (Nfya)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    29508 (Nfya)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    29508 (Nfya)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    29508 (Nfya)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    29508 (Nfya)
SSDB
Motif
Pfam: CBFB_NFYA
Other DBs
NCBI-GeneID: 29508
NCBI-ProteinID: NP_036997
RGD: 70976
Ensembl: ENSRNOG00000012702
UniProt: P18576
Position
9
AA seq 341 aa
MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPL
MVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAV
QVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTIL
QQGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSV
PAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRH
AMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggagcagtatacagcaaacagcaatagttccacagagcagatcgtggtgcaggctggc
cagattcagcagcagcagcagggtggtgtcactgctgtccagctgcagactgaggcccag
gtggcatccgcctcaggccagcaagtccagaccctccaggtagttcaggggcagccatta
atggtgcaagtcagtggaggccagctgattacatcaactggccaacccatcatggtacag
gctgtgcctggtggacaaggccaaactatcatgcaagtacctgtgtctggaacacaaggt
ttacagcagatacagttggtaccccctggacagatccagatccagggcgggcaggctgtg
caggtgcaaggccagcagggacagacccagcagatcatcattcagcagccacagaccgcg
gtcaccgctggccagactcagacacaacaacagattgctgtccagggacagcaagtggcc
cagactgctgaagggcagactattgtctaccagccagttaatgcagatggcacaatcctc
cagcaaggcatgatcaccatcccagcagccagtttggcaggggcacagatcgttcagaca
ggagccaataccaacacaaccagtagtggacaagggactgtcactgtgacactgccagtg
gcagggaatgtggtcaactcaggaggaatggtcatgatggtaccaggggctggctctgtg
cctgctatccaaagaatccctttacctggggcagagatgctggaagaagagcccctgtac
gtgaacgccaaacagtatcaccgcatccttaagaggagacaagcgagggccaagctagag
gcagaagggaagatcccaaaggaaagaaggaaatacctccatgagtctcggcaccgacac
gccatggcacggaagcgtggggaagggggccgcttcttctctccaaaagaaaaggacagt
cctcacatgcaggatccaaaccaagctgatgaagaagccatgacacagatcatccgagtt
tcctaa

DBGET integrated database retrieval system