KEGG   Rattus norvegicus (rat): 25337Help
Entry
25337             CDS       T01003                                 

Gene name
Nfyc, CBF-C
Definition
(RefSeq) nuclear transcription factor Y subunit gamma
  KO
K08066  nuclear transcription factor Y, gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04612  Antigen processing and presentation
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    25337 (Nfyc)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    25337 (Nfyc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25337 (Nfyc)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    25337 (Nfyc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBFD_NFYB_HMF Histone E1-E2_ATPase CENP-X
Motif
Other DBs
NCBI-GeneID: 25337
NCBI-ProteinID: NP_036998
RGD: 3173
Ensembl: ENSRNOG00000010735
UniProt: Q62725
Position
5q36
AA seq 335 aa AA seqDB search
MSTEGGFGSTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKM
ISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR
DELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIII
AQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIP
VQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQ
IQQVTMPAGQDLAQPMFIQSANQPSDGQTPQVTGD
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtccacagaaggagggtttggcagtaccagcagcagtgatgcccagcaaagcctccag
tccttctggcccagagtcatggaagaaatccgaaacttaacagtgaaagatttccgagta
caagaactaccactggctcgtattaagaagattatgaaactggatgaagatgtgaagatg
atcagtgcagaagcccctgtgctgtttgctaaggcagcccagatcttcatcacagagctg
actcttcgagcctggatccacacagaggataacaagcgtcgtactcttcagaggaatgat
attgctatggcaattacaaaatttgatcagtttgactttctcatcgacattgttccaaga
gatgaactgaaacctccaaagcgccaggaggaggtacgccagtctgtgactcccgcggag
cctgtccagtactacttcacgctggctcagcagcccactgctgtccaggtccagggacag
cagcaaggccagcagaccaccagttctacgaccaccatccagcctggccagatcatcatt
gcgcagcctcaacagggtcagaccacacccgtgaccatgcaggttggagaaggtcagcag
gtgcagattgtgcaggcccaacctcagggtcaggcccagcaggcccagagtggtactgga
cagaccatgcaggtgatgcagcagatcattaccaacacaggagagatccaacagatcccg
gtgcagctgaatgccggccagttgcagtatatccgcttagcccagcctgtatcaggcacc
caagttgtgcagggacagatccagacccttgctaccaatgcccaacagatcacacagaca
gaggtccaacaaggacagcagcagttcagccagttcacagacggacagcagctgtaccag
atccagcaagtcaccatgcctgcaggccaagaccttgcccagcccatgtttattcagtca
gccaaccagccctctgatgggcagaccccccaggtgactggagactga

DBGET integrated database retrieval system