KEGG   Rattus norvegicus (rat): 25339
Entry
25339             CDS       T01003                                 

Gene name
Npr3, ANP-CR, NPRC
Definition
(RefSeq) natriuretic peptide receptor 3
  KO
K12325  atrial natriuretic peptide clearance receptor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    25339 (Npr3)
SSDB
Motif
Pfam: ANF_receptor
Other DBs
NCBI-GeneID: 25339
NCBI-ProteinID: NP_037000
RGD: 3196
Ensembl: ENSRNOG00000019184
UniProt: P41740
Position
2q16
AA seq 535 aa
MRSLLLFTFSACVLLARALLAGGASSGGGDTGPGNRRREREALAAQKIEVLVLLPRDDSY
LFSLARVRPAIEYALRSVEGNGTGRKLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARG
AKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDTEYSHLTRVAPAYAKMG
EMMLALFRHHHWSRAALLYSDDKLERNCYFTLEGVHEVFQEEGLHTSAYNFDETKDLDLD
DIVRYIQGSERVVIMCASGDTIRRIMLAVHRHGMTSGDYAFFNIELFNSSSYGDGSWKRG
DKHDFEAKQAYSSLQTVTLLRTAKPEFEKFSMEVKSSVEKQGLNEEDYVNMFVEGFHDAI
LLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVVAMTDTE
AGTQEVIGDYFGKEGRFKMRSNVKYPWGSLKLRIDETRIVEHTNSSPCKSCGLEESAVTG
IVVGALLGAGLLMAFYFFRKKYRITIERRNHQEESNIGKHRELREDSIRSHFSVA
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgcggtccctgctgctgttcactttctcggcgtgcgtgctgctggcccgggcgctgctg
gctggcggtgcgagtagtggcggtggggacaccgggccaggcaacaggcgccgggagaga
gaggcgctggcggctcaaaagatcgaggtgcttgtgctattgccccgggacgattcgtac
ttgttctcgctggcccgggtgaggccggccatcgagtacgcgctgcgtagcgtggagggc
aatggcaccggcaggaagctgctgccgcccggcactcgcttccaggtggcctatgaagac
tctgactgtggcaaccgtgcgctcttcagtttggtggaccgcgtggcggcggcgcgcggc
gccaagccggacctcatcctgggtccggtgtgcgagtacgctgcggcgccggtggcccgg
ctggcgtctcactgggacctgccgatgctgtccgcaggagcgctggccgcgggtttccag
cacaaggacacggagtactcgcacctcacgcgcgtggcgcctgcctacgccaagatggga
gagatgatgctcgctctgttccgccaccaccactggagccgcgctgccctgctctacagc
gacgacaaactcgagagaaactgctacttcactctcgagggggtccacgaggttttccag
gaggagggcttgcacacgtctgcctacaatttcgacgagaccaaagacttggacctggac
gacatagtgcgctacatccagggcagtgagcgagtggtgatcatgtgtgccagtggtgac
accattcggagaatcatgttggcggtgcacagacacggcatgaccagtggagactatgct
ttcttcaacattgaactcttcaacagttcttcttacggagatggctcgtggaagagaggg
gacaaacacgactttgaagctaagcaagcttactcatccctccaaacagtcaccctgctg
aggaccgcgaagcctgagtttgagaagttttccatggaggtgaaaagttctgttgagaaa
caagggctcaatgaggaggattacgtgaacatgttcgttgaaggcttccatgatgccatc
ctcctctacgttctggctttgcatgaagtgctcagagctggctacagcaagaaggatggg
gggaaaatcatccagcagacttggaacaggacatttgaaggtatcgccgggcaggtgtcc
atagatgctaatggggatcggtatggagacttctctgtggttgccatgactgatacagaa
gcaggtacccaggaggtcattggtgattactttggaaaagaaggccggttcaaaatgcga
tccaatgtcaaatatccttggggctctttgaaattgagaatagatgaaaccagaattgtg
gagcacaccaacagctctccttgcaaatcatgtggcctagaagaatcagcagtgacagga
attgttgtgggggccctactaggtgctggtttgctaatggccttctactttttcaggaag
aaatacagaataaccattgagaggcgaaatcaccaagaagaaagcaacattgggaaacat
cgagagctgcgggaagattccatcagatcacatttttcggtggcttaa

DBGET integrated database retrieval system