KEGG   Rattus norvegicus (rat): 25342
Entry
25342             CDS       T01003                                 

Symbol
Oxtr
Name
(RefSeq) oxytocin receptor
  KO
K04229  oxytocin receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    25342 (Oxtr)
   04024 cAMP signaling pathway
    25342 (Oxtr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25342 (Oxtr)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    25342 (Oxtr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25342 (Oxtr)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Oxytocin
    25342 (Oxtr)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srsx Gaa1
Other DBs
NCBI-GeneID: 25342
NCBI-ProteinID: NP_037003
RGD: 3239
Ensembl: ENSRNOG00000005806
UniProt: P70536
Position
4:complement(145598549..145614674)
AA seq 388 aa
MEGTPAANWSVELDLGSGVPPGEEGNRTAGPPQRNEALARVEVAVLCLILFLALSGNACV
LLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLGTWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYVTWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA
AAEGNDAAGGAGRAALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWD
VNAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFHELVQRFFCCSARYLKGSRPGETS
VSKKSNSSTFVLSRRSSSQRSCSQPSSA
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggagggcacgccagcagccaactggagtgtcgagttggacctcgggagtggagtgcca
ccaggggaggagggcaaccgcacggccgggccaccacaacgcaacgaggccctggcgcgc
gtggaggtggcggtcctgtgcctcattctgttcctggctctgagtggcaacgcgtgtgtg
ctgctggcgctgcgcaccacgcgccacaagcactcgcgcctcttctttttcatgaagcac
ctgagcatcgctgacctggtggtggctgtgtttcaggtgcttccgcagctgctgtgggac
atcaccttccgcttctatgggcccgacctgctgtgtcgtctggtcaaatacttgcaggtg
gtgggcatgttcgcctccacctacctgctgctgctgatgtcgctcgaccgctgtctggcc
atctgccagccgctgcgctccctgcgccgccgaaccgaccgcctggcggtgctggggacg
tggcttggctgcctggtggccagtgctccgcaggtgcacattttctcgctgcgcgaagtg
gcggacggagtcttcgattgctgggcggtcttcatccaaccctggggacccaaggcctac
gtcacatggatcacgctcgccgtctacattgtaccggtcatcgtgctggccgcctgctac
ggcctcatcagcttcaagatctggcagaatctgagactcaagacggcagcggcggcggcg
gctgccgaggggaatgacgcggcgggtggagctgggcgtgcggcgttggcacgggtcagt
agtgtcaagcttatctccaaggccaaaatccgcacggtgaagatgaccttcatcatcgta
ctggccttcatcgtgtgctggacacctttcttcttcgtgcagatgtggagcgtttgggac
gtcaatgcgcccaaggaagcttctgccttcatcattgccatgctcttggccagcctcaac
agctgctgcaacccgtggatctacatgctcttcacaggtcacctcttccacgaactcgtg
cagcgcttcttctgctgctctgctcgttacctgaagggcagccggcccggcgagacgagt
gtcagcaagaagagcaactcatccacctttgtcctgagccgtcgcagctcaagccagagg
agctgctctcagccatcttcagcatga

DBGET integrated database retrieval system