KEGG   Rattus norvegicus (rat): 25342Help
Entry
25342             CDS       T01003                                 

Gene name
Oxtr, OT-R, OTR, OTR1
Definition
(RefSeq) oxytocin receptor
  KO
K04229  oxytocin receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    25342 (Oxtr)
   04024 cAMP signaling pathway
    25342 (Oxtr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25342 (Oxtr)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    25342 (Oxtr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25342 (Oxtr)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Oxytocin
    25342 (Oxtr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 25342
NCBI-ProteinID: NP_037003
RGD: 3239
Ensembl: ENSRNOG00000005806
UniProt: P70536
Position
4q41
AA seq 388 aa AA seqDB search
MEGTPAANWSVELDLGSGVPPGEEGNRTAGPPQRNEALARVEVAVLCLILFLALSGNACV
LLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLGTWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYVTWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA
AAEGNDAAGGAGRAALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWD
VNAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFHELVQRFFCCSARYLKGSRPGETS
VSKKSNSSTFVLSRRSSSQRSCSQPSSA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggagggcacgccagcagccaactggagtgtcgagttggacctcgggagtggagtgcca
ccaggggaggagggcaaccgcacggccgggccaccacaacgcaacgaggccctggcgcgc
gtggaggtggcggtcctgtgcctcattctgttcctggctctgagtggcaacgcgtgtgtg
ctgctggcgctgcgcaccacgcgccacaagcactcgcgcctcttctttttcatgaagcac
ctgagcatcgctgacctggtggtggctgtgtttcaggtgcttccgcagctgctgtgggac
atcaccttccgcttctatgggcccgacctgctgtgtcgtctggtcaaatacttgcaggtg
gtgggcatgttcgcctccacctacctgctgctgctgatgtcgctcgaccgctgtctggcc
atctgccagccgctgcgctccctgcgccgccgaaccgaccgcctggcggtgctggggacg
tggcttggctgcctggtggccagtgctccgcaggtgcacattttctcgctgcgcgaagtg
gcggacggagtcttcgattgctgggcggtcttcatccaaccctggggacccaaggcctac
gtcacatggatcacgctcgccgtctacattgtaccggtcatcgtgctggccgcctgctac
ggcctcatcagcttcaagatctggcagaatctgagactcaagacggcagcggcggcggcg
gctgccgaggggaatgacgcggcgggtggagctgggcgtgcggcgttggcacgggtcagt
agtgtcaagcttatctccaaggccaaaatccgcacggtgaagatgaccttcatcatcgta
ctggccttcatcgtgtgctggacacctttcttcttcgtgcagatgtggagcgtttgggac
gtcaatgcgcccaaggaagcttctgccttcatcattgccatgctcttggccagcctcaac
agctgctgcaacccgtggatctacatgctcttcacaggtcacctcttccacgaactcgtg
cagcgcttcttctgctgctctgctcgttacctgaagggcagccggcccggcgagacgagt
gtcagcaagaagagcaactcatccacctttgtcctgagccgtcgcagctcaagccagagg
agctgctctcagccatcttcagcatga

DBGET integrated database retrieval system