KEGG   Rattus norvegicus (rat): 25344Help
Entry
25344             CDS       T01003                                 

Gene name
Phb
Definition
(RefSeq) prohibitin
  KO
K17080  prohibitin 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    25344 (Phb)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25344 (Phb)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Mitochondrial movement
    25344 (Phb)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   25344 (Phb)
  Exosomal proteins of breast cancer cells
   25344 (Phb)
  Exosomal proteins of colorectal cancer cells
   25344 (Phb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 Med2 DUF4290
Motif
Other DBs
NCBI-GeneID: 25344
NCBI-ProteinID: NP_114039
RGD: 3322
Ensembl: ENSRNOG00000046799
UniProt: P67779
Position
10q26
AA seq 272 aa AA seqDB search
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPW
VQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLP
SITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFT
EAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRK
LEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaaagtgtttgagtccatcggaaagttcggcctggccttagcagttgcagga
ggcgtggtgaactctgctctatataacgtggatgccggacacagagctgtcatcttcgac
cgattccgtggcgtgcaggacatcgtggtaggggaagggactcacttcctcatcccctgg
gtacagaagccaatcatctttgactgccgctctcgaccacgtaatgtgccggtcatcacc
ggcagcaaagacttgcagaatgtcaacatcacactacgtatcctcttccggccggtggcc
agccagcttcctcgtatctacaccagcattggcgaggactatgatgagcgggtgctgcca
tctatcaccacagagatcctcaagtcggtggtggctcgattcgatgctggagaattgatt
acccagcgagagctggtctccaggcaggtgagtgatgacctcacagagcgagcagcaaca
ttcgggctcatcctggatgacgtgtccctgacacatctgaccttcgggaaggagttcaca
gaggcggtggaagccaaacaggtggctcagcaggaagcagagagagccagatttgtggtg
gaaaaggctgagcagcagaagaaggcggccatcatctctgctgagggtgactccaaagcg
gctgagctgatcgccaactcactggccaccgccggggatggcctgatcgagctgcgaaag
ctggaagctgctgaggacattgcttatcagctctcccgctctcggaacatcacctacctg
ccagcagggcagtccgtgctcctccagctcccccagtaa

DBGET integrated database retrieval system