KEGG   Rattus norvegicus (rat): 25349
Entry
25349             CDS       T01003                                 

Gene name
Scn2b
Definition
(RefSeq) sodium channel subunit beta-2 precursor
  KO
K04846  voltage-gated sodium channel type II beta
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25349 (Scn2b)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   25349 (Scn2b)
SSDB
Motif
Pfam: V-set ig Ig_3 I-set Adeno_E3_CR2 Syndecan PALP Ig_2 EphA2_TM Vpu Mqo FAM176
Other DBs
NCBI-GeneID: 25349
NCBI-ProteinID: NP_037009
RGD: 3633
Ensembl: ENSRNOG00000016221
UniProt: P54900
Position
8
AA seq 215 aa
MHRDAWLPRPAFSLTGLSLFFSLVPSGRSMEVTVPTTLSVLNGSDTRLPCTFNSCYTVNH
KQFSLNWTYQECSNCSEEMFLQFRMKIINLKLERFGDRVEFSGNPSKYDVSVTLKNVQLE
DEGIYNCYITNPPDRHRGHGKIYLQVLLEVPPERDSTVAVIVGASVGGFLAVVILVLMVV
KCVRRKKEQKLSTDDLKTEEEGKTDGEGNAEDGAK
NT seq 648 nt   +upstreamnt  +downstreamnt
atgcacagggatgcctggctacctcgccctgccttcagtctcacggggctcagtctgttt
ttctctttggtgccctcggggcggagcatggaagtcacagtccccaccactcttagtgtc
ctcaacgggtctgatacccgcctgccctgtaccttcaactcctgctataccgtgaaccac
aagcagttctctctgaactggacttaccaggagtgtagcaattgctcagaggagatgttc
ctccagttccgaatgaagatcatcaacctgaagctggagcggtttggagaccgcgtagag
ttctcggggaaccccagtaagtacgacgtgtcagtgactctaaagaacgtgcagctagaa
gacgaaggcatttacaactgctacatcaccaaccctccagaccgccaccgtggccatggc
aagatctacctgcaggtccttctagaagtgcccccagagcgggactccacggtggcagtc
atcgtgggtgcctcagtggggggtttcctggctgtggtcatcttggtgctgatggtggtc
aaatgtgtgaggaggaaaaaagagcagaagctgagcacggatgacctgaagaccgaagag
gaaggcaagacggatggcgagggcaacgcggaagatggcgccaagtaa

DBGET integrated database retrieval system