KEGG   Rattus norvegicus (rat): 25352
Entry
25352             CDS       T01003                                 

Gene name
Sod3
Definition
(RefSeq) extracellular superoxide dismutase [Cu-Zn] precursor
  KO
K16627  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25352 (Sod3)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     25352 (Sod3)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Enzymes
   25352 (Sod3)
SSDB
Motif
Pfam: Sod_Cu
Other DBs
NCBI-GeneID: 25352
NCBI-ProteinID: NP_037012
RGD: 3733
Ensembl: ENSRNOG00000003869
UniProt: Q08420
Position
14
AA seq 244 aa
MVAFLFCNLLLVACGSVTWTMSDTGESGVDLADRLDLVEKIGDTHSKDLEIWMELGKQRE
ADAREMHAVCRVQPSAMLPPDQPQITGLVLFRQLGPSSRLEASFNLEGFPAEQNTSNHAI
HVHEFGDLSQGCESTGPHYNPLGVPHPQHPGDFGNFVVRDGRLWKHRMGLATSLAGPHSI
LGRAVVVHAGEDDLGKGGNQASVQNGNAGRRLACCVVGTSNSEAWESQTKERKKRRRESE
CKTT
NT seq 735 nt   +upstreamnt  +downstreamnt
atggtggccttcttgttctgcaacctgctactggtggcctgtggctctgtcacctggacc
atgtcagataccggagagtccggtgtcgacttagcagaccggcttgacctggttgagaag
ataggcgacacgcactccaaagacctggagatctggatggagctaggaaaacaacgggag
gcggatgccagggagatgcacgcagtctgcagggtacagccctcagccatgctgcctccc
gatcagccacagatcacaggcttggtcctcttccggcagctggggcccagctccagactt
gaggcctccttcaatctggagggcttcccagccgagcagaacacctccaaccacgccatc
cacgtgcatgagttcggggacctgagccagggctgcgagtccaccggaccacactacaac
ccgctgggtgtgccgcacccacagcacccgggggacttcggcaacttcgtggtgcgcgat
ggccgcctttggaagcatcgaatgggcctggccacgtcactggccggaccgcactcgatc
ttgggccgcgctgtggtggtccacgctggcgaggacgacctgggtaaaggtggcaaccag
gccagcgtgcagaacggcaacgcaggtcgccggctcgcctgctgcgtggtaggcaccagc
aactcggaggcctgggagagccagacaaaggagcgcaagaagcggcggcgggagagcgag
tgcaagaccacttaa

DBGET integrated database retrieval system