KEGG   Rattus norvegicus (rat): 25360Help
Entry
25360             CDS       T01003                                 

Gene name
Tshr, TSHRA
Definition
(RefSeq) thyroid stimulating hormone receptor
  KO
K04249  thyrotropin receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04918  Thyroid hormone synthesis
rno04923  Regulation of lipolysis in adipocytes
rno05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    25360 (Tshr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25360 (Tshr)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    25360 (Tshr)
   04918 Thyroid hormone synthesis
    25360 (Tshr)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    25360 (Tshr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25360 (Tshr)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Thyrotropin
    25360 (Tshr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 LRR_8 LRR_5
Motif
Other DBs
NCBI-GeneID: 25360
NCBI-ProteinID: NP_037020
RGD: 3911
Ensembl: ENSRNOG00000003972
Vega: OTTRNOG00000000863
UniProt: P21463
Position
6q31
AA seq 764 aa AA seqDB search
MRPGSLLQLTLLLALPRSLWGRGCTSPPCECHQEDDFRVTCKELHQIPSLPPSTQTLKLI
ETHLKTIPSLAFSSLPNISRIYLSIDATLQRLEPHSFYNLSKMTHIEIRNTRSLTYIDPD
ALTELPLLKFLGIFNTGLRIFPDLTKIYSTDVFFILEITDNPYMTSVPENAFQGLCNETL
TLKLYNNGFTSIQGHAFNGTKLDAVYLNKNKYLTAIDKDAFGGVYSGPTLLDVSSTSVTA
LPSKGLEHLKELIAKNTWTLKKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLM
CNESSIRNLRQRKSVNVMRGPVYQEYEEGLGDNHVGYKQNSKFQEGPSNSHYYVFFEEQE
DEIIGFGQELKNPQEETLQAFDSHYDYTVCGDNEDMVCTPKSDEFNPCEDIMGYKFLRIV
VWFVSPMALLGNVFVLFVLLTSHYKLTVPRFLMCNLAFADFCMGVYLLLIASVDLYTHTE
YYNHAIDWQTGPGCNTAGFFTVFASELSVYTLTVITLERWYAITFAMRLDRKIRLRHAYT
IMAGGWVSCFLLALLPMVGISSYAKVSICLPMDTDTPLALAYIALVLLLNVVAFVIVCSC
YVKIYITVRNPQYNPRDKDTKIAKRMAVLIFTDFMCMAPISFYALSALMNKPLITVTNSG
VLLVLFYPLNSCANPFLYAIFTKAFQRDVFILLSKFGLCKHQAQAYQAQRVCPNNNTGIQ
IQKIPQDTRQSLPNVQDTYEPLGSSHLTPKLQGRISEEYTQTAL
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgaggccagggtccctgctccagctcactctgctgctcgccctgcccaggagcctctgg
ggcagagggtgtacttctccaccctgcgaatgccaccaggaggacgacttcagagtcacc
tgcaaggaactccaccaaatccccagcctaccgcccagcacccagactctgaagctcatc
gagactcacctgaagaccattcccagtcttgccttttcgagcctgcccaatatttccagg
atctatctatccatagatgccactctgcagcgactggagccacattctttctacaatttg
agtaaaatgactcacatagaaatccggaacaccagaagcttgacttacatagaccctgat
gccttaacagagctccccttgctcaagtttcttggaattttcaatactggacttagaata
ttccctgacttgaccaaaatttattccacggatgtgttctttatactagaaatcacagac
aacccttacatgacgtcagtccctgaaaacgcattccagggactatgcaatgaaaccttg
accctgaaactatacaacaatggatttacttcaatccaaggacatgctttcaatggaaca
aagctggatgctgtttacctaaacaagaataaatatctgacagctatagacaaagatgcc
tttggaggagtatacagtggacccactttgctagacgtgtcttccaccagcgttactgct
cttccttccaaaggcctggagcacctcaaagagctgatcgcgaagaacacctggactctc
aaaaagctccccctgtccttgagcttcctccacctcactcgggctgacctctcttaccca
agtcactgctgtgcttttaagaaccagaagaaaatcaggggaatcctagagtctttgatg
tgtaatgagagtagtatccggaacctgcgtcaaagaaagtcagtgaacgtcatgaggggt
cccgtctaccaggaatatgaagaaggtctgggtgacaaccatgttgggtacaaacaaaac
tccaagttccaggagggcccaagcaactctcactattacgtcttctttgaagaacaagag
gacgagatcatcggtttcggccaagagctcaaaaatcctcaggaagagactctccaagcc
ttcgacagccactatgactacactgtgtgtggggacaacgaggacatggtgtgtaccccc
aagtcagacgagtttaacccctgtgaagatatcatgggctacaagttcctgagaatcgtg
gtatggtttgtcagtccgatggctctcctgggcaacgtctttgtcctgttcgtcctgctt
actagccactacaaactgaccgtgccacgcttcctgatgtgcaacctggcctttgcagat
ttctgcatgggggtttacctgcttctcattgcctccgtagacctgtacacacacactgag
tactacaaccacgccattgactggcagacgggccctggatgcaacacggctggtttcttc
actgtttttgccagcgagttatcagtgtacacactgacggtcatcaccctggagcgatgg
tatgccatcaccttcgccatgcgcctggataggaagatccgcctcaggcacgcttatacc
atcatggcgggggggtgggtttcctgcttccttctcgccttgctcccaatggtgggaata
agcagctacgccaaggtcagcatctgcctgccgatggacacagacacccctcttgccctg
gcgtacatcgcccttgttctcctgctcaacgttgttgcctttgttattgtctgctcctgc
tatgtgaagatttacatcaccgtccgaaatccccagtacaaccctcgagataaagacacc
aagattgccaagaggatggccgtgttgatcttcactgacttcatgtgcatggcgcccatc
tccttctatgccctgtcagcgcttatgaacaagcctctgatcactgtcactaactccggg
gtcttgttggttctcttctacccactcaactcctgtgctaacccatttctctatgccatt
ttcaccaaggccttccagagggatgtgttcatcctactcagcaagtttggcctctgcaaa
caccaggcccaagcctatcaggcccagagagtctgtcccaacaacaacactggtattcag
atccaaaagatcccccaggacacaaggcagagtctccccaatgtgcaagatacctatgaa
ccgcttggaagctcccacctgactccgaaactacagggacggatctcagaagagtacacg
caaacagccctgtaa

DBGET integrated database retrieval system