KEGG   Rattus norvegicus (rat): 25361Help
Entry
25361             CDS       T01003                                 

Gene name
Vcam1, VCAM1B
Definition
(RefSeq) vascular cell adhesion molecule 1
  KO
K06527  vascular cell adhesion molecule 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04514  Cell adhesion molecules (CAMs)
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05143  African trypanosomiasis
rno05144  Malaria
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    25361 (Vcam1)
   04668 TNF signaling pathway
    25361 (Vcam1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    25361 (Vcam1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    25361 (Vcam1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25361 (Vcam1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    25361 (Vcam1)
  09174 Infectious disease: parasitic
   05144 Malaria
    25361 (Vcam1)
   05143 African trypanosomiasis
    25361 (Vcam1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25361 (Vcam1)
   04091 Lectins [BR:rno04091]
    25361 (Vcam1)
CD molecules [BR:rno04090]
 Proteins
  25361 (Vcam1)
Lectins [BR:rno04091]
 I-type lectins (Siglecs)
  25361 (Vcam1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 C2-set ig Ig_2 V-set Ig_6 C2-set_2 Ig_5 Ig_4 ICAM_N Adhes-Ig_like tRNA_anti-codon
Motif
Other DBs
NCBI-GeneID: 25361
NCBI-ProteinID: NP_037021
RGD: 3952
Ensembl: ENSRNOG00000014333
UniProt: P29534
Position
2q41
AA seq 739 aa AA seqDB search
MPVKMVAIFGASTVLWILFAVSQAFKIEISPEYKTLAQIGDSMLLTCSTTGCESPSFSWR
TQIDSPLNGKVKTEGAKSVLTMDPVSFENEHSYLCTATCNSGKLERGIQVDIYSFPKDPE
IQFSGPLEVGKPVMVKCLAPDVYPIDRLEIELFKGDRLMKKQDFVDEMAKKSLETKSLEV
IFTPVIEDIEKALVCRAKLYIDQTDSIPKERETVRELQVYTSPKNTEISVHPSTRLHEGA
AVTMTCASEGLPAPEIFWSKKLDNGVLQLLSGNATLTLIAMRMEDSGIYVCEGVNLVGRD
KTEVELIVQEKPFTVDISPGSQVAAQVGDSVVLTCAAVGCDSPSFSWRTQTDSPLNGEVR
DEGATSTLTLSPVGVEDEHSYLCTVTCQRRKLEKTIQVEVYSFPEDPEIEISGPLVHGRP
VTVNCTVPNVYPFDHLEIELLKGETTLLNKFLREEIGTKSLETKSLEMTFIPTAEDTGKA
LVCLAKLHSSQMESEPKQRQSTQTLYVNVAPKEPTIWVSPSPVPEEGSPVNLTCSSDGFP
TPKILWSRQLKNGELQPLSQNTTLSFMATKMEDSGIYVCEGINEAGISKKSVELIIQGSS
KDIQLTVFPSKSVKEGDTVIISCTCGSVPEIWIILKKKAKTGDMVLKSVNGSYTIRKAQL
QDAGVYECESKTEVGSQLRSLTLDVKGKENNKDYFSPELLALYFASSLVIPAIGMIIYFA
RKANMKGSYSLVEAQKSKV
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgaagatggtcgcgatcttcggagcctcaacggtactttggatactgtttgca
gtctctcaagcttttaaaatcgagatctcccctgaatacaaaacgctcgctcagattgga
gactccatgctcctgacttgcagcaccacaggctgtgagtcgccatcattctcttggaga
acccagatagacagtccactaaatgggaaggtgaagacagagggggccaagtccgttctg
accatggaccctgtcagctttgagaatgaacactcttacctgtgcacagcaacatgtaac
tctgggaaactggaaagaggaatccaagtggacatctactcattccctaaggatccagag
attcaattcagtggccccctggaggttgggaagccggtcatggtcaagtgtttggctcct
gatgtttacccaattgacagactggagatagaactgttcaagggtgaccgtctcatgaag
aaacaggattttgtagatgagatggcaaagaagtctctggaaaccaagagtttggaagtc
atctttactcctgtcattgaggatattgaaaaggctcttgtttgccgagctaaattatac
attgaccaaactgattctattcccaaagaaagggagactgtcagagaactacaagtctac
acctcccccaagaatacagagatctctgtacatccctccacaaggctacatgagggtgct
gctgtgacgatgacatgtgccagcgagggtctaccagctcctgagattttctggagcaag
aaattagataatggagttctacagctcctctcgggaaatgccaccctcaccttaattgct
atgaggatggaagattctggaatctatgtgtgtgaaggagtgaatctggttgggagagac
aaaacagaagtggaattaattgttcaagagaaaccatttactgttgacatctcccctgga
tctcaggtggctgcacaggttggggattccgttgttctgacatgtgctgctgttggctgt
gactctccctccttttcttggagaacccagacagacagtcccctcaatggggaggtgagg
gatgaaggggctacatccacactgacgctgagccctgtgggtgttgaggatgagcactct
tacctgtgcactgtgacctgtcagcgaaggaaactggagaagacaatccaagtggaggtc
tactcattccctgaagacccagaaattgaaataagtggaccacttgtacacgggagacct
gtcactgtcaactgcacggtccctaatgtgtacccctttgaccatctggagattgaacta
ctgaagggggagacaacactgttgaataaatttttaagggaggaaattggcacaaagtct
ctagagaccaaaagtttggaaatgaccttcatccccaccgctgaagacaccgggaaagct
cttgtttgcctcgctaagttacacagcagtcaaatggagtctgaacccaaacaaaggcag
agtacacagactctttatgtcaacgttgctccgaaagaacccaccatctgggttagcccc
tctcctgtcccagaggagggcagtcctgtgaacctgacctgctcaagtgatggttttcca
actcccaaaatcctgtggagcagacagctaaagaacggggaactgcagcctctttctcaa
aatacaacactctccttcatggctacaaaaatggaagattccggcatttatgtatgtgaa
gggattaatgaggctggaattagcaaaaaatcagttgaactgattatccaaggctcttcg
aaggacatacagcttacagtcttcccatctaagagcgtcaaagagggagacactgtcatt
atctcctgtacttgtggaagtgtgcccgaaatatggataattctgaaaaagaaagccaag
acaggagacatggtgctaaagtctgttaatggctcgtacaccatccgcaaggcacagctg
caggatgccggagtatacgagtgtgaatcgaaaaccgaagtcggctcgcagttgcgaagt
ttaacacttgatgtgaaaggaaaagaaaataacaaggactatttttcccctgaactcctt
gcactctactttgcatcctccttggtaatacccgccattgggatgatcatttactttgca
agaaaagccaacatgaaaggatcgtacagtctggtggaggcacagaagtcaaaagtgtag

DBGET integrated database retrieval system