KEGG   Rattus norvegicus (rat): 25364
Entry
25364             CDS       T01003                                 

Gene name
Asic2, Accn1, BNC1k, BNaC1, MDEG, MDEG1, MDEG2
Definition
(RefSeq) acid sensing ion channel subunit 2
  KO
K04828  acid-sensing ion channel 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04742  Taste transduction
rno04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    25364 (Asic2)
   04750 Inflammatory mediator regulation of TRP channels
    25364 (Asic2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25364 (Asic2)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   25364 (Asic2)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 25364
NCBI-ProteinID: NP_001029186
RGD: 2017
Ensembl: ENSRNOG00000058308
UniProt: Q62962
Position
10q26
AA seq 512 aa
MDLKESPSEGSLQPSSIQIFANTSTLHGIRHIFVYGPLTIRRVLWAVAFVGSLGLLLVES
SERVSYYFSYQHVTKVDEVVAQSLVFPAVTLCNLNGFRFSRLTTNDLYHAGELLALLDVN
LQIPDPHLADPTVLEALRQKANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGH
QDFTTVFTKYGKCYMFNSGEDGKPLLTTVKGGTGNGLEIMLDIQQDEYLPIWGETEETTF
EAGVKVQIHSQSEPPFIQELGFGVAPGFQTFVATQEQRLTYLPPPWGECRSSEMGLDFFP
VYSITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGLLAEKDSNYCLC
RTPCNLTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLDIFFEALNYETIEQK
KAYEVAALLGDIGGQMGLFIGASLLTILELFDYIYELIKEKLLDLLGKEEEEGSHDENMS
TCDTMPNHSETISHTVNVPLQTALGTLEEIAC
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggacctcaaggagagccccagtgagggcagcctgcaaccttccagtatccagatcttc
gccaatacctccactctccatggcatccgccacatcttcgtgtatgggccgctgaccatc
cggcgtgtgctttgggcagtggccttcgtcggatccctgggcctgctgctggtggagagc
tcggagagggtgtcctactatttctcttatcagcatgttaccaaggtggatgaagtggtg
gcccagagcctggtcttcccagctgtgaccctctgcaacctcaatggcttccggttctcc
aggcttaccaccaacgacttgtaccacgctggggagttgctggccctgctggatgtcaac
ctacagattcccgacccgcatctggcagaccccacggtgctggaggccctccgacagaag
gccaacttcaaacactacaaaccgaagcagttcagcatgctggagttcctgcaccgggta
ggccatgacctgaaggatatgatgctctactgcaagttcaaggggcaggagtgtgggcat
caagacttcaccacagtgtttacaaaatacgggaagtgttacatgtttaactcaggcgag
gatggcaagccgctgctcaccacggtcaagggggggacgggcaacgggctggagatcatg
ctggacattcagcaagatgagtacctgcccatctggggagagacagaggaaacaacgttt
gaagcaggagtgaaggttcagatccacagtcagtctgagccgcctttcatccaagagctg
ggctttggggtggctccggggttccagaccttcgtggccacacaagagcagaggctcaca
tatctgcccccaccatggggggagtgccggtcctcagagatgggactcgacttctttcct
gtttacagcatcacagcctgtcggattgactgtgagacccgctacatcgtggagaactgt
aactgccgcatggtccacatgccaggggacgcccctttctgcacccctgagcagcacaag
gagtgtgcagagcctgccctcggtctactggcagaaaaggacagcaattactgtctctgc
aggacaccctgcaacctgacacgctacaacaaagagctctccatggtgaagatccccagc
aagacgtcagccaagtacttagagaagaaatttaacaaatcggaaaaatatatctcagag
aacattcttgttctggacatattttttgaggcgctcaattacgaaacaattgaacagaag
aaggcgtatgaagttgctgccttacttggtgacatcggtggtcagatgggactgttcatt
ggtgctagtctcctcacaatactagagctctttgattatatttatgagctgatcaaagag
aagctattagacctgcttggcaaagaagaagaggaagggagccacgatgagaacatgagc
acctgtgacacaatgccaaaccactctgaaaccatcagccacactgtgaacgtgcccctg
cagacagctttgggcaccctggaggagattgcctgctga

DBGET integrated database retrieval system