KEGG   Rattus norvegicus (rat): 25366
Entry
25366             CDS       T01003                                 

Gene name
Acvr2b
Definition
(RefSeq) activin A receptor type 2B
  KO
K13596  activin receptor type-2B [EC:2.7.11.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    25366 (Acvr2b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25366 (Acvr2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    25366 (Acvr2b)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25366 (Acvr2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25366 (Acvr2b)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     25366 (Acvr2b)
Protein kinases [BR:rno01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   25366 (Acvr2b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Activin_recp Pkinase_fungal
Other DBs
NCBI-GeneID: 25366
NCBI-ProteinID: NP_113742
RGD: 2028
Ensembl: ENSRNOG00000014477
UniProt: P38445 A0A0G2JSN4
Structure
PDB: 
6MAC 1NYS 1NYU

Position
8q32
AA seq 512 aa
MTAPWAALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCY
ASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPG
GPEVTYEPPPTAPTLLTVLAYSLLPIGGLSLIVLLAFWMYRHRKPPYGHVDIHEDPGPPP
PSPLVGLKPLQLLEIKARGRFGCVWKAQLMNDFVAVKIFPLQDKQSWQSEREIFSTPGMK
HENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDYLKGNIITWNELCHVAETMSRGLSY
LHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQVG
TRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLPFEEEIGQ
HPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVSL
IRRSVNSSTSDCLVSLVTSVTNVDLLPKESSI
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgacggcgccctgggcggccctcgcccttctctggggatcgctgtgcgccggttccggg
cgaggggaagctgagactcgggagtgcatctactacaacgccaactgggagctggagcgc
accaaccagagcggcctggagcgctgcgagggggaacaggacaagcggctgcactgctat
gcctcgtggcgcaacagctcgggcaccatcgagctggtgaagaagggctgctggctagat
gacttcaattgctacgacaggcaggagtgtgtggccactgaggagaacccccaggtgtat
ttctgctgctgtgaaggcaatttctgcaacgagcgcttcacccatttgccggagcctggg
ggcccagaagtcacgtacgagccacccccgacagcccccaccctgctcacggtgctggcc
tattcgctgctgcccattggaggcctctctctcatcgtcctgctggccttctggatgtac
cgacatcgaaagcctccctacggccacgtggacatccatgaggaccctgggcctcctccc
ccatcgcctctggtgggcctgaagccgctacagttgctggagatcaaggctcgaggtcgc
tttggctgcgtctggaaggctcagctcatgaacgactttgtggctgtgaagatcttccca
cttcaggacaagcagtcgtggcagagtgagcgggagatcttcagcacaccgggcatgaag
cacgaaaacctcctgcagttcattgctgcagagaaacgaggctccaacctggaggtggag
ctgtggctcatcacagccttccacgacaagggctccctcacggattacctcaaggggaac
atcatcacgtggaacgagctgtgtcatgtggcagagacgatgtcacgaggcctctcgtac
ctgcatgaggatgtgccgtggtgtcgtggcgagggccacaagccttctattgcccacagg
gacttcaaaagcaagaatgttctgctgaagagcgacctcaccgcggtgctggctgacttt
ggcctggctgttcggtttgagccggggaagcctccaggggatacccatgggcaggttggc
accagacggtacatggcccccgaggtgctggagggggccatcaacttccagagagacgcc
ttcctgcgtatcgacatgtacgccatgggcctggtgctgtgggagctcgtttctcgttgc
aaggccgcagatgggcctgtcgatgagtacatgctgcctttcgaggaagagattggccaa
cacccttcactggaggagcttcaggaggtggttgtccacaagaagatgaggcccaccatt
aaggatcactggctgaaacatccgggcctggcccagctctgcgtgaccatcgaggagtgc
tgggaccatgatgcagaggctcgtctgtctgcaggctgtgtggaagagcgggtatccctg
atcaggaggtcggtcaacagctctacctcggactgtctcgtctctctggtgacctccgtc
accaatgtggacctgctccctaaagagtccagcatctaa

DBGET integrated database retrieval system