KEGG   Rattus norvegicus (rat): 25367Help
Entry
25367             CDS       T01003                                 

Gene name
Adarb1, Adar2, Red1
Definition
(RefSeq) adenosine deaminase, RNA-specific, B1
  KO
K13194  double stranded RNA-specific editase B [EC:3.5.-.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    25367 (Adarb1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.-  Acting on carbon-nitrogen bonds, other than peptide bonds
    3.5.-.-  
     25367 (Adarb1)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    25367 (Adarb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: A_deamin dsrm
Motif
Other DBs
NCBI-GeneID: 25367
NCBI-ProteinID: NP_037026
RGD: 2033
Ensembl: ENSRNOG00000001227
UniProt: P51400
Structure
PDB: 

Position
20p12
AA seq 711 aa AA seqDB search
MDIEDEENMSSSSTDVKENRNLDNMPPKDSSTPGPGEGIPLSNGGGGSTSRKRPLEEGSN
GHSKYRLKKRRKTPGPVLPKNALMQLNEIKPGLQYMLLSQTGPVHAPLFVMSVEVNGQVF
EGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGF
ETPDKSEPPFYVGSNGDDSFSSSGDVSLSASPVPASLTQPPLPIPPPFPPPSGKNPVMIL
NELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALATVFNLH
LDQTPSRQPVLSEGLQLHLPQVLADAVSRLVLGKFSDLTDNFSSPHARRKVLSGVVMTTG
TDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLRFLYAQLELYLNNKED
QKKSIFQKSERGGFRLKDTVQFHLYISTSPCGDARIFSPHEPVLEGMAPDSHQLTEPADR
HPNRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQGERLLTMSCSDKIARWNVVGIQG
ALLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLYTLNKPLLSGISNAEAR
QPGKAPNFSVNWTVGDTAIEVINATTGKDELGRPSRLCKHALYCRWMRVHGKVPPHLLRT
KITKPTTYHESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSFTP
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atggatatagaagacgaagagaatatgagttccagcagcactgatgttaaagaaaaccgc
aatctggacaacatgccccccaaggacagcagcacacccgggcctggcgagggtattccg
ctctccaacgggggtggtgggagcaccagcaggaagcggcccctggaggagggcagcaat
ggccactccaagtaccgcctgaagaagcgaaggaaaacgccagggcccgttctacccaag
aacgccctgatgcagctgaacgagatcaaaccgggcttacagtacatgctgctgtcccag
acaggacccgtgcacgcacctctgtttgtcatgtctgtggaggtaaacgggcaggtcttt
gaaggctccggccctacaaagaagaaggcaaagctgcatgctgctgagaaggccctgcgg
tcttttgtccagtttcccaacgcctctgaggcccacctggccatgggaaggaccctctcc
gtgaacacagacttcacgtccgaccaggcggacttccccgacacgctcttcaatggcttt
gagactccagacaagtcggagccacccttctacgtaggctccaatggggatgactccttc
agctcaagcggagacgttagcctgtcagcctccccagtgcctgccagccttacccagcct
cctctgcccatcccaccaccattcccacccccaagtgggaagaaccccgtgatgatcttg
aatgagctgcgcccagggctgaagtatgacttcctctccgagagtggggagagccacgcc
aagagctttgtcatgtccgtggtggtagatggccagttctttgagggctcagggagaaac
aagaagcttgccaaggcccgggctgcacagtctgccttggctactgtcttcaatttgcac
ttggaccaaacgccatctcgccagcctgtcctcagtgagggtctccagttgcatttgcca
caggtattggcagatgctgtctcacgcctggtcctgggtaagttcagtgacctgacagac
aacttttcctcccctcacgcacgaagaaaagtgctctctggagtagtgatgaccacaggt
acagatgtcaaagatgccaaggtgataagtgtttcgacagggacgaagtgcatcaacggc
gaatacatgagtgaccgtggcctggctctcaatgactgccacgcagagataatctcccga
aggtccctgctcaggtttctatacgcacagctcgagctttacttaaataacaaagaagac
cagaaaaagtccatatttcagaagtcagagcggggtgggttccggctgaaggataccgtg
cagttccacctgtacatcagcacctcaccctgcggagacgccagaatattctctccccat
gagcccgtgctagagggtatggcgccagactcccaccagctgacagaaccggctgataga
catccgaatcgcaaagcaaggggacagctgcggactaaaatagaatctggcgaggggaca
atccctgtgcgctcaaatgccagcatccagacctgggatggggtgctgcagggggaacgg
ctgctcaccatgtcctgcagtgacaagatagcacgctggaacgtggtgggcatccagggg
gccctgctcagcattttcgtggagcccatctacttctccagcatcatcctgggcagcctg
taccacggggaccacctctccagggccatgtaccagcggatctccaacatagaggacctg
ccaccgctctacaccctcaacaagcccctgctcagcggtatcagcaatgcagaggcacgg
cagccagggaaggcacccaacttcagtgtcaactggacggtgggcgacacggccattgag
gtcatcaatgccacaacagggaaggatgagctaggccgcccctcccgcctgtgtaagcac
gcgctgtactgtcgctggatgcgggtacacggaaaggtgcccccccacctgctgcgcacc
aagatcaccaagcccaccacctaccacgagtccaagctggcagcgaaggagtaccaggct
gccaaggcacgtctgttcactgccttcatcaaggcggggctgggcgcctgggtggagaag
cccacagagcaggaccagttctccttcactccctga

DBGET integrated database retrieval system