KEGG   Rattus norvegicus (rat): 25368Help
Entry
25368             CDS       T01003                                 

Gene name
Adk, AK
Definition
(RefSeq) adenosine kinase
  KO
K00856  adenosine kinase [EC:2.7.1.20]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    25368 (Adk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.20  adenosine kinase
     25368 (Adk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB Phos_pyr_kin Raf1_N
Motif
Other DBs
NCBI-GeneID: 25368
NCBI-ProteinID: NP_037027
RGD: 2046
Ensembl: ENSRNOG00000012325
UniProt: Q64640 A0A0G2JSL8
Position
15p16
AA seq 361 aa AA seqDB search
MAAADEPKPKKLKVEAPEALSENVLFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDK
HKELFDELVKKFKVEYHAGGSTQNSMKVAQWMIQEPHRAATFFGCIGIDKFGEILKSKAA
DAHVDAHYYEQNEQPTGTCAACITGGNRSLVANLAAANCYKKEKHLDLENNWMLVEKARV
YYIAGFFLTVSPESVLKVARYAAENNRTFTLNLSAPFISQFFKEALMEVMPYVDILFGNE
TEAATFAREQGFETKDIKEIARKTQALPKVNSKRQRTVIFTQGRDDTIVATGNDVTAFPV
LDQNQEEIVDTNGAGDAFVGGFLSQLVSNKPLTECIRAGHYAASVIIRRTGCTFPEKPNF
H
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgcggacgagccgaagcccaagaagctcaaggtggaagcgccagaagcgctg
agtgaaaatgtgctgtttggaatggggaatcctcttcttgacatctctgctgtggtagac
aaagatttccttgataagtattctctgaaaccaaacgaccagatcttggccgaagacaag
cacaaggaattgtttgatgaacttgtaaaaaaattcaaagttgaatatcatgccggtggg
tccacgcagaattcaatgaaagtggctcagtggatgattcaggagccacacagagcagca
acgttcttcggatgcattgggatagataagttcggggagatcctgaagagcaaagccgca
gatgcacacgtggacgcccattactatgagcagaacgagcagcccacaggaacgtgcgct
gcatgcatcaccggtggcaaccggtctcttgttgctaaccttgctgccgccaattgttat
aagaaagaaaagcaccttgatctggagaacaactggatgttggtagagaaagccagagtt
tactacatagctggcttctttctcaccgtctccccagagtcagtgttgaaagtggctcgc
tatgctgccgagaacaacaggaccttcactctgaacctgtccgcaccgttcattagccag
ttcttcaaggaagccttgatggaagtcatgccttatgttgacatcctctttggaaatgag
acggaggctgccacttttgctagagagcaaggctttgagactaaagacattaaagaaata
gccagaaagacgcaggctcttccaaaggtgaactcgaagaggcagaggaccgtgatcttc
acccaagggagagatgacactatagtggctacaggaaatgatgtcactgctttccctgtc
ttggatcaaaaccaggaagagatcgttgacaccaatggagctggagatgcatttgtagga
gggtttctgtctcagctggtctccaacaagcctctgactgaatgcatccgggccgggcac
tatgcagcgagcgtcatcattaggcgaactggctgtacttttcctgagaagccaaacttc
cactga

DBGET integrated database retrieval system