KEGG   Rattus norvegicus (rat): 25369Help
Entry
25369             CDS       T01003                                 

Gene name
Adora2a, A2ar, ADENO, Adora2l1
Definition
(RefSeq) adenosine A2a receptor
  KO
K04266  adenosine receptor A2a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04270  Vascular smooth muscle contraction
rno05012  Parkinson disease
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    25369 (Adora2a)
   04020 Calcium signaling pathway
    25369 (Adora2a)
   04024 cAMP signaling pathway
    25369 (Adora2a)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25369 (Adora2a)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    25369 (Adora2a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    25369 (Adora2a)
  09165 Substance dependence
   05034 Alcoholism
    25369 (Adora2a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25369 (Adora2a)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    25369 (Adora2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx GPR_Gpa2_C
Motif
Other DBs
NCBI-GeneID: 25369
NCBI-ProteinID: NP_445746
RGD: 2049
Ensembl: ENSRNOG00000001302
UniProt: P30543
Position
20p12
AA seq 410 aa AA seqDB search
MGSSVYITVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSLAAADIAVGVLAIPFA
ITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGVRAKG
IIAICWVLSFAIGLTPMLGWNNCSQKDGNSTKTCGEGRVTCLFEDVVPMNYMVYYNFFAF
VLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHAAKSLAIIVGLFALC
WLPLHIINCFTFFCSTCRHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRKIIRT
HVLRRQEPFQAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSATHSGRRPNGYTLGL
GGGGSAQGSPRDVELPTQERQEGQEHPGLRGHLVQARVGASSWSSEFAPS
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgggctcctcggtgtacatcacggtggagctggccatcgctgtgctggccatcctgggc
aacgtgctcgtgtgctgggccgtgtggatcaacagtaacctgcagaacgtcaccaacttc
tttgtggtatcgctggcggcggctgacattgcagtgggtgtgctcgccatccccttcgct
atcaccatcagcaccggcttctgcgccgcctgccacggctgcctcttcttcgcctgtttt
gtcctggtcctcacgcagagttccatctttagcctcttggctatcgccatcgaccgctac
atcgccatccgaattccactccggtacaatggcttggtgacaggtgtgagggcgaagggc
atcattgcaatttgctgggtgctgtcgtttgccattggcctgacccccatgctgggctgg
aacaactgcagtcagaaagacgggaactccacgaagacctgcggcgagggccgggtgacc
tgtctgttcgaggacgtggtgcccatgaattacatggtttactacaacttctttgcgttc
gtgttactgccccttctgctcatgctggccatctacctacggatttttctggcggcccgg
agacagctgaagcagatggagagccagcccctgccaggggagcggactcggtccacgctg
cagaaggaggtccacgctgccaagtccctggccatcatcgtcgggctctttgctctgtgc
tggttgccgctgcacatcatcaactgtttcaccttcttctgctccacgtgccggcacgcc
cctccgtggctcatgtacctggccatcatcctctcccacagcaactccgtcgtcaacccc
ttcatctacgcctacaggatccgggagttccgccagaccttccggaagatcatccgaacc
cacgtcctgaggcggcaggaacccttccaggcagggggttccagtgcctgggccctggca
gctcacagcactgagggagagcaggttagcctccgccttaatggccaccccctgggggta
tgggccaacggcagtgccacccattccggacggcggcccaatggctacactctggggctg
gggggtggagggagtgcccaaggctctcctcgggatgtggagcttcctacccaggagcgc
caggaaggccaagagcaccctggcctaaggggtcatctggtccaggctagagtaggagct
tcctcatggtcttcagagtttgccccttcctga

DBGET integrated database retrieval system