KEGG   Rattus norvegicus (rat): 25374
Entry
25374             CDS       T01003                                 

Gene name
Alad, ALADR, aminolevulinatedelta-dehydratase
Definition
(RefSeq) aminolevulinate dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00860  Porphyrin and chlorophyll metabolism
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    25374 (Alad)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     25374 (Alad)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25374 (Alad)
SSDB
Motif
Pfam: ALAD DUF2016 PE-PPE
Other DBs
NCBI-GeneID: 25374
NCBI-ProteinID: NP_037031
RGD: 2083
Ensembl: ENSRNOG00000015206
Vega: OTTRNOG00000000141
UniProt: P06214
Position
5q24
AA seq 330 aa
MHHQSVLHSGYFHPLLRAWQTTPSTVSATNLIYPIFVTDVPDDVQPIASLPGVARYGVNQ
LEEMLRPLVEAGLRCVLIFGVPSRVPKDEQGSAADSEDSPTIEAVRLLRKTFPTLLVACD
VCLCPYTSHGHCGLLSENGAFLAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKA
ALLKHGLGNRVSVMSYSAKFASCFYGPFRDAAQSSPAFGDRRCYQLPPGARGLALRAVAR
DIQEGADILMVKPGLPYLDMVQEVKDKHPELPLAVYQVSGEFAMLWHGAKAGAFDLRTAV
LESMTAFRRAGADIIITYFAPQLLKWLKEE
NT seq 993 nt   +upstreamnt  +downstreamnt
atgcaccaccagtccgttctgcacagtggctactttcacccactgcttcgggcctggcag
accaccccctccaccgtcagtgccaccaacctcatctatcccatctttgtcacggatgtt
cctgatgatgtccagcccattgccagcctcccgggagtggccaggtatggcgtaaaccag
ctagaggagatgctgagacctctggtggaagccggccttcgctgtgtcctgatctttggc
gtccccagcagagttcccaaggatgaacagggctctgcagctgactcagaggactcccca
actattgaggctgtccgtctgctgaggaagaccttccctaccctcctagtggcctgtgat
gtctgcctgtgcccctacacctcccatggccactgtggcctcctgagtgaaaatggagcc
ttcctagcagaggaaagccgacaacggttggcagaggtggcactggcctatgccaaggca
ggttgtcaggttgtagctccatcagacatgatggatggacgagttgaagccatcaaggct
gccctgctaaaacatggacttggcaacagggtctctgtgatgagctatagtgccaaattt
gcctcctgtttctatggtcctttccgggatgcagctcagtcaagcccagctttcggagac
cgacgctgttatcagctgcctcctggagcccgtggcctggccctccgagcagtggcccgg
gacattcaagagggagctgacatactcatggtaaagccgggattaccctacctggatatg
gtgcaggaggtgaaggacaagcaccccgagctccccctcgcagtataccaggtgtccgga
gagtttgccatgttgtggcacggagccaaggctggggcctttgatctcaggactgctgta
ctggagtccatgacggccttccgcagagccggtgctgacattatcatcacctactttgca
ccccagctgttgaagtggctgaaggaagagtga

DBGET integrated database retrieval system