KEGG   Rattus norvegicus (rat): 25375
Entry
25375             CDS       T01003                                 

Gene name
Aldh3a1
Definition
(RefSeq) aldehyde dehydrogenase, dimeric NADP-preferring
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00340  Histidine metabolism
rno00350  Tyrosine metabolism
rno00360  Phenylalanine metabolism
rno00410  beta-Alanine metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    25375 (Aldh3a1)
  09105 Amino acid metabolism
   00340 Histidine metabolism
    25375 (Aldh3a1)
   00350 Tyrosine metabolism
    25375 (Aldh3a1)
   00360 Phenylalanine metabolism
    25375 (Aldh3a1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    25375 (Aldh3a1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    25375 (Aldh3a1)
   00982 Drug metabolism - cytochrome P450
    25375 (Aldh3a1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    25375 (Aldh3a1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     25375 (Aldh3a1)
SSDB
Motif
Pfam: Aldedh LuxC MukF_M Cir_Bir_Yir
Other DBs
NCBI-GeneID: 25375
NCBI-ProteinID: NP_114178
RGD: 2088
Ensembl: ENSRNOG00000002331
UniProt: P11883
Structure
PDB: 
1AD3

Position
10
AA seq 453 aa
MSSISDTVKRAREAFNSGKTRSLQFRIQQLEALQRMINENLKSISGALASDLGKNEWTSY
YEEVAHVLEELDTTIKELPDWAEDEPVAKTRQTQQDDLYIHSEPLGVVLVIGAWNYPFNL
TIQPMVGAVAAGNAVILKPSEVSGHMADLLATLIPQYMDQNLYLVVKGGVPETTELLKER
FDHIMYTGSTAVGKIVMAAAAKHLTPVTLELGGKSPCYVDKDCDLDVACRRIAWGKFMNS
GQTCVAPDYILCDPSIQNQIVEKLKKSLKDFYGEDAKQSRDYGRIINDRHFQRVKGLIDN
QKVAHGGTWDQSSRYIAPTILVDVDPQSPVMQEEIFGPVMPIVCVRSLEEAIQFINQREK
PLALYVFSNNEKVIKKMIAETSSGGVTANDVIVHITVPTLPFGGVGNSGMGAYHGKKSFE
TFSHRRSCLVKSLLNEEAHKARYPPSPAKMPRH
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgagcagtatcagtgacaccgtgaaacgggccagggaggcctttaactccggcaagact
cgatcgctgcagttccgaatccagcagttggaggcgctgcagcgcatgatcaatgagaac
ctgaaaagcatctctggggcgctggcctctgacctgggcaagaacgaatggacctcctac
tatgaggaagtggctcacgtactggaggagcttgataccacaattaaggagctccctgat
tgggctgaggatgagcctgtggccaagactcgccagacccagcaggatgacctttacatc
cactcggagcccctgggtgtggtccttgtcataggtgcttggaactaccccttcaacctc
accatccagcccatggtgggtgccgttgctgcaggaaacgcagtgatcctcaagccctca
gaagtgagcgggcacatggcagacctgctagcgacactcatccctcagtatatggaccag
aatctgtacctagtggtcaaagggggtgtccctgaaaccacggagctgctcaaagagagg
tttgaccacatcatgtacactgggagcacagccgtagggaagattgttatggccgctgcc
gccaagcatctgactcctgtcaccctggagcttggagggaaaagcccttgttacgtggac
aaggactgtgatctagatgtggcttgcaggcgtatcgcctgggggaaatttatgaacagt
ggccagacctgtgtggccccagactacatcctctgtgacccctcgattcagaaccaaatc
gtggagaagctcaagaagtcactcaaagatttctatggggaagatgctaagcagtcccgt
gattatgggaggatcatcaatgaccgtcacttccagcgggtcaaaggcctgattgacaac
cagaaagtagcccatggaggcacttgggaccagtcctcacgatacatagctccaaccatc
ctggtggatgtggacccccagtccccagtgatgcaggaggagatctttgggccggtgatg
cccattgtgtgtgttcgaagcttggaggaggccattcaatttatcaaccagcgtgagaag
cccctggcactctatgtgttctccaacaatgagaaggtgatcaagaaaatgatcgcagag
acatccagcggtggagtgacagccaatgacgtcattgttcacatcaccgtgcccactttg
ccctttggtggtgtggggaacagcggcatgggggcctaccatggcaagaaaagcttcgag
accttctcccaccgccgctcttgcctggtgaagtctctgttgaatgaagaagctcacaag
gccaggtatcccccaagcccagccaagatgccccggcactga

KEGG   Rattus norvegicus (rat): 309147
Entry
309147            CDS       T01003                                 

Gene name
Aldh3b1
Definition
(RefSeq) aldehyde dehydrogenase family 3 member B1
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00340  Histidine metabolism
rno00350  Tyrosine metabolism
rno00360  Phenylalanine metabolism
rno00410  beta-Alanine metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    309147 (Aldh3b1)
  09105 Amino acid metabolism
   00340 Histidine metabolism
    309147 (Aldh3b1)
   00350 Tyrosine metabolism
    309147 (Aldh3b1)
   00360 Phenylalanine metabolism
    309147 (Aldh3b1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    309147 (Aldh3b1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    309147 (Aldh3b1)
   00982 Drug metabolism - cytochrome P450
    309147 (Aldh3b1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    309147 (Aldh3b1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     309147 (Aldh3b1)
SSDB
Motif
Pfam: Aldedh LuxC
Other DBs
NCBI-GeneID: 309147
NCBI-ProteinID: NP_001006999
RGD: 1359546
Ensembl: ENSRNOG00000017512
UniProt: Q5XI42
Position
1
AA seq 468 aa
MDSFEDKLQQLREAFNAGRTRSAEFRAAQLQGLSHFLRDNKQQLQEALAQDLHKSAFESE
VSEIAISQAEVDLALRNLRSWMKDEKVSKNLATQLDSAFIRKEPFGLVLIIVPWNYPLNL
TLVPLVGAIAAGNCVVLKPSEISKATEKILAEVLPRYLDQSCFAVVLGGPQETGQLLEHR
FDYIFFTGNTYVGKIVMAAAAKHLTPITLELGGKNPCYVDDNCDPQTVANRVAWFRYFNA
GQTCVAPDYVLCSQEMQERLVPALQNAITRFYGDNPQTSPNLGRIINQKHFERLQGLLGC
GRVAIGGQSDEGERYIAPTVLVDVQETEPVMQEEIFGPILPLVTVTNLDEAIEFINRREK
PLALYAFSKRSQVIKQVLARTSSGGFCGNDGFMHMTLSSLPFGGVGTSGMGRYHGKFSFD
TFSNQRACLLRSPGMEKINDLRYPPYTSRNLRVLLVAMEKRCCSCTLL
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggactcgtttgaagataagcttcagcagctgcgagaggccttcaatgccgggaggacg
aggtcagctgagttccgggctgcacagctgcaaggcctgagccacttcctcagagacaac
aaacagcagctgcaggaggcgctggcccaagacctacacaagtcagcctttgagtcggag
gtgtccgagattgccatcagtcaggctgaggtggacctggccctcaggaacctgcggtct
tggatgaaggatgagaaagtgtccaagaatctggccacacagctggactcagccttcatc
cggaaggagcccttcgggctggtcctcatcatcgtgccctggaattaccccttgaacctg
acactcgtgcctctggtgggggccattgctgcagggaattgtgtggtactcaaaccctca
gagatcagcaaggccactgaaaagatcctggctgaggtcctgccccgctatctggaccag
agctgcttcgctgtggtgctgggtgggcctcaggaaactgggcagctgctggaacacagg
ttcgactacatcttcttcacagggaacacttatgtaggcaagatcgtcatggctgctgct
gccaaacacctgacgcccatcaccctggagctggggggtaagaacccctgctatgtggat
gacaactgcgacccccagacagtggccaaccgtgtggcctggttccgctactttaacgcc
ggccagacctgtgtggccccggattatgtcctgtgtagccaggagatgcaggagcggctg
gtgcccgccctgcagaatgccatcacgcgtttctatggagacaacccacagacctccccc
aacctgggcagaatcatcaaccagaagcatttcgagcggctccagggattgctgggctgt
ggccgtgtggccatcgggggccagagcgatgagggggagcgctacattgcccccacagtg
ttagtggatgtgcaagagacagagcccgtgatgcaggaggagatctttggacccatcctg
cccctggtgactgtgacgaacctggatgaggcaattgagttcatcaaccggagggagaag
ccacttgcgctgtacgccttctctaagagaagccaggtcatcaaacaggtgttggcccgg
accagcagtgggggcttctgcgggaacgatggcttcatgcacatgaccctgtccagcctt
ccttttggaggagtgggaaccagcgggatgggcaggtaccacggcaagttctcctttgac
accttttccaaccagcgtgcctgtttgctgcgcagccctgggatggagaaaatcaacgac
ctgcgctacccgccctacaccagtcgcaacctcagggtgttgctggtggccatggaaaag
agatgctgcagctgcacgctgctgtaa

KEGG   Rattus norvegicus (rat): 688778
Entry
688778            CDS       T01003                                 

Definition
(RefSeq) aldehyde dehydrogenase family 3 member B3 isoform X1
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00340  Histidine metabolism
rno00350  Tyrosine metabolism
rno00360  Phenylalanine metabolism
rno00410  beta-Alanine metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    688778
  09105 Amino acid metabolism
   00340 Histidine metabolism
    688778
   00350 Tyrosine metabolism
    688778
   00360 Phenylalanine metabolism
    688778
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    688778
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    688778
   00982 Drug metabolism - cytochrome P450
    688778
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    688778
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     688778
SSDB
Motif
Pfam: Aldedh LuxC
Other DBs
NCBI-GeneID: 688778
NCBI-ProteinID: XP_038957242
RGD: 1585230
Position
1
AA seq 406 aa
MSEIILCQNEVDLALKNLQTWMKDESVSTNFLTKFSSAFIRKEPFGLVLIIAPWNYPLNL
MIMPLVGAIAAGNCVVLKPSEMSKNTEKVLAELLPQYLDQSCFAVVLGGPEETGQLLKHK
FDYIFFTGSPRVGKIVMAAAAKHLTPITLELGGKNPCYVDDNCDPQTVANRVAWFRYFNA
GQTCVAPDYVLCSQEMQERLVPALQNAITRFYGDNPQTSPNLGRIINQKHFERLQGLLGC
GRVAIGGQSDEGERYIAPTVLVDVQETEPVMQEEIFGPILPLVTVRNLDEAIEFINRREK
PLALYAYSNNVEVIKQVLARTSSGSFCGNDGFMHMTLSSLPFGGVGSSGMGRYHGKFSFD
TFSNQRACLLSCSGMEKLNDLRYPPYSPRRQQLLRWAMGSQSCSLL
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgagtgagatcatcctgtgtcagaacgaggtggacctggccctcaagaacctgcagacg
tggatgaaggacgagtctgtgtccaccaactttctcacgaagttcagctcagccttcatc
cggaaagagccctttggcctggtacttatcatcgctccctggaattatcctctgaacttg
atgatcatgcctctagtgggggccattgctgcaggaaactgtgtggtgctgaagccatca
gaaatgagcaagaacacagagaaggtgctggcagagctgctaccccagtatctggaccag
agctgctttgctgtggtgctgggtgggcccgaggagaccgggcagctgctgaagcacaaa
tttgactacatcttcttcacagggagccctcgggtaggcaagatcgtcatggctgctgct
gccaaacacctgacgcccatcaccctggagctggggggtaagaacccctgctatgtggat
gacaactgcgacccccagacagtggccaaccgtgtggcctggttccgctactttaacgcc
ggccagacctgtgtggccccggattatgtcctgtgtagccaggagatgcaggagcggctg
gtgcccgccctgcagaatgccatcacgcgtttctatggagacaacccacagacctccccc
aacctgggcagaatcatcaaccagaagcatttcgagcggctccagggattgctgggctgt
ggccgtgtggccatcgggggccagagcgatgagggggagcgctacattgcccccacagtg
ttagtggatgtgcaggagacagagcccgtgatgcaggaggagatctttggacccatcctg
cccctggtgactgtgaggaacctggatgaggcgattgagttcatcaaccggagggagaag
ccacttgcgctgtatgcctattccaacaatgtggaggtcatcaaacaggtgttggcccgg
accagcagtgggagcttctgcgggaacgatggctttatgcacatgaccctgtccagcctt
ccttttggaggagtgggatcgagtgggatgggcaggtaccacggcaagttctcctttgac
accttttctaatcagcgtgcctgcctgctgagctgctctgggatggaaaagcttaatgac
ctccgttacccaccctatagtccccgtaggcaacagctgctaagatgggctatgggctcc
cagagctgctccctcctgtga

KEGG   Rattus norvegicus (rat): 688800
Entry
688800            CDS       T01003                                 

Gene name
Aldh3b2
Definition
(RefSeq) aldehyde dehydrogenase family 3 member B2
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00340  Histidine metabolism
rno00350  Tyrosine metabolism
rno00360  Phenylalanine metabolism
rno00410  beta-Alanine metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    688800 (Aldh3b2)
  09105 Amino acid metabolism
   00340 Histidine metabolism
    688800 (Aldh3b2)
   00350 Tyrosine metabolism
    688800 (Aldh3b2)
   00360 Phenylalanine metabolism
    688800 (Aldh3b2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    688800 (Aldh3b2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    688800 (Aldh3b2)
   00982 Drug metabolism - cytochrome P450
    688800 (Aldh3b2)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    688800 (Aldh3b2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     688800 (Aldh3b2)
SSDB
Motif
Pfam: Aldedh LuxC
Other DBs
NCBI-GeneID: 688800
NCBI-ProteinID: XP_038957241
RGD: 1584166
Position
1
AA seq 417 aa
MQSLQSAFESDMSEIILCQNEVDLALKNLQTWMKDESVSTNFLTKFSSAFIRKEPFGLVL
IIAPWNYPLNLMIMPLVGAIAAGNCVVLKPSEMSKNTEKVLAELLPQYLDQSCFAVVLGG
PEETGQLLKHKFDYIFFTGSPRVGKIVMAAAAKHLTPITLELGGKNPCYVDDNCDPQTVA
NRVAWFRYFNAGQTCVAPDYVLCSQEMQERLVPALQNAITRFYGDNPQTSPNLGRIINQK
HFERLQGLLGCGRVAIGGQSDEGERYIAPTVLVDVQETEPVMQEEIFGPILPLVTVRSLD
EAVNFINQREKPLALYAFSNNGQVVTQMLECTSSGSFGGNDGFLYLTLPALPLGGVGNSG
MGRYHGKFSFDTFSHQRACLLSSPGMEKLNDLRYPPYGTWDQQLISWAMGSQSCTLL
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgcaaagcctccagtcagccttcgagtcagacatgagtgagatcatcctgtgtcagaac
gaggtggacctggccctcaagaacctgcagacgtggatgaaggacgagtctgtgtccacc
aactttctcacgaagttcagctcagccttcatccggaaagagccctttggcctggtactt
atcatcgctccctggaattatcctctgaacttgatgatcatgcctctagtgggggccatt
gctgcaggaaactgtgtggtgctgaagccatcagaaatgagcaagaacacagagaaggtg
ctggcagagctgctaccccagtatctggaccagagctgctttgctgtggtgctgggtggg
cccgaggagaccgggcagctgctgaagcacaaatttgactacatcttcttcacagggagc
cctcgggtaggcaagatcgtcatggctgctgctgccaaacacctgacgcccatcaccctg
gagctggggggtaagaacccctgctatgtggatgacaactgcgacccccagacagtggcc
aaccgtgtggcctggttccgctactttaacgccggccagacctgtgtggccccggattat
gtcctgtgtagccaggagatgcaggagcggctggtgcccgccctgcagaatgccatcacg
cgtttctatggagacaacccacagacctcccccaacctgggcagaatcatcaaccagaag
catttcgagcggctccagggattgctgggctgtggccgtgtggccatcgggggccagagc
gatgagggggagcgctacattgcccccacagtgttagtggatgtgcaggagacagaacct
gtgatgcaggaggagatctttgggcccatcctgcccttggtgactgtgcggagcctggat
gaggccgttaacttcattaaccagcgggagaagccactggcattgtatgccttctccaac
aatggccaggtggtgacccagatgttggaatgcaccagcagcggtagcttcggaggcaac
gacggcttcctctacctgaccctaccagctctgcccctggggggagttggtaacagtggg
atgggcaggtaccatggcaagttctcctttgacaccttctcccaccagcgtgcctgcctg
ctgagcagccctgggatggaaaagcttaatgacctccgttacccaccttatggtacctgg
gaccaacaactgataagctgggctatgggctcccagagctgcactctcctgtga

DBGET integrated database retrieval system