KEGG   Rattus norvegicus (rat): 25379
Entry
25379             CDS       T01003                                 

Gene name
Anp32a, Anp32, LANP
Definition
(RefSeq) acidic nuclear phosphoprotein 32 family member A
  KO
K18646  acidic leucine-rich nuclear phosphoprotein 32 family member A/C/D
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    25379 (Anp32a)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     25379 (Anp32a)
SSDB
Motif
Pfam: LRR_4 LRR_9 LRR_8 LRR_6 LRR_1 SDA1 CDC45
Other DBs
NCBI-GeneID: 25379
NCBI-ProteinID: NP_037035
RGD: 2116
Ensembl: ENSRNOG00000058484
UniProt: P49911
Position
8
AA seq 247 aa
MEMDKRIYLELRNRTPSDVKELVLDNCRSIEGKIEGLTDEFEELEFLSTINVGLTSISNL
PKLNKLKKLELSENRISGDLEVLAEKCPNLKHLNLSGNKIKDLSTIEPLKKLENLKSLDL
FNCEVTNLNAYRENVFKLLPQVMYLDGYDRDNKEAPDSDVEGYVEDDDEEDEDEEEYDEY
AQLVEDEEEEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEDAAEEEGSQKRKREPD
DEGQEDD
NT seq 744 nt   +upstreamnt  +downstreamnt
atggagatggacaaacggatttatttagagctgcggaacaggacgccctctgatgtgaaa
gagctggtcctggataactgtcggtcaattgaaggcaaaatcgaaggcctcacggatgag
tttgaagaactggaattcctaagtacaatcaacgtaggcctcacctccatttccaactta
ccaaagttaaacaaactcaagaagcttgaattaagcgaaaacagaatctcaggggacctg
gaagtattggcagagaaatgtccgaaccttaagcatctaaatttaagtggcaacaaaata
aaagatctcagcacaatagagccgctgaagaagttagagaatctcaagagcctagacctg
tttaactgtgaggtgaccaacctgaatgcctaccgagaaaacgtgttcaagctcctgccc
caggtcatgtacctcgatggctatgacagagacaacaaggaggcccctgactctgatgtt
gagggctacgtggaggatgacgacgaggaagatgaggatgaggaggagtatgatgaatac
gcccagctagtggaagatgaagaggaagaggatgaggaggaagaaggggaggaagaggac
gtgagtggagaggaagaggaggatgaagaaggttacaacgacggggaagtggatgatgag
gaagatgaagaagatgctgctgaagaagaagggagtcagaagcgaaaacgagagcccgat
gacgagggccaagaggatgactaa

DBGET integrated database retrieval system