KEGG   Rattus norvegicus (rat): 25385Help
Entry
25385             CDS       T01003                                 

Gene name
Faslg, Apt1Lg1, CD95-L, Fasl, Tnfsf6, Tnlg1a
Definition
(RefSeq) Fas ligand
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04068  FoxO signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04217  Necroptosis
rno04650  Natural killer cell mediated cytotoxicity
rno04722  Neurotrophin signaling pathway
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno04940  Type I diabetes mellitus
rno05142  Chagas disease (American trypanosomiasis)
rno05143  African trypanosomiasis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05168  Herpes simplex virus 1 infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    25385 (Faslg)
   04010 MAPK signaling pathway
    25385 (Faslg)
   04068 FoxO signaling pathway
    25385 (Faslg)
   04151 PI3K-Akt signaling pathway
    25385 (Faslg)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25385 (Faslg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    25385 (Faslg)
   04217 Necroptosis
    25385 (Faslg)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    25385 (Faslg)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    25385 (Faslg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25385 (Faslg)
   05205 Proteoglycans in cancer
    25385 (Faslg)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    25385 (Faslg)
   05330 Allograft rejection
    25385 (Faslg)
   05332 Graft-versus-host disease
    25385 (Faslg)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    25385 (Faslg)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    25385 (Faslg)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    25385 (Faslg)
   05162 Measles
    25385 (Faslg)
   05164 Influenza A
    25385 (Faslg)
   05161 Hepatitis B
    25385 (Faslg)
   05160 Hepatitis C
    25385 (Faslg)
   05168 Herpes simplex virus 1 infection
    25385 (Faslg)
   05163 Human cytomegalovirus infection
    25385 (Faslg)
   05165 Human papillomavirus infection
    25385 (Faslg)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    25385 (Faslg)
   05143 African trypanosomiasis
    25385 (Faslg)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    25385 (Faslg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25385 (Faslg)
   04052 Cytokines and growth factors [BR:rno04052]
    25385 (Faslg)
   04090 CD molecules [BR:rno04090]
    25385 (Faslg)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   25385 (Faslg)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Tumor necrosis fators
   25385 (Faslg)
CD molecules [BR:rno04090]
 Proteins
  25385 (Faslg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 25385
NCBI-ProteinID: NP_037040
RGD: 3880
Ensembl: ENSRNOG00000002978
Vega: OTTRNOG00000000198
UniProt: P36940 A0A0U5J7X8
Position
13q22
AA seq 278 aa AA seqDB search
MQQPVNYPCPQIYWVDSSATSPWAPPGSVFSCPSSGPRGPGQRRPPPPPPPPSPLPPPSQ
PPPLPPLSPLKKKDNIELWLPVIFFMVLVALVGMGLGMYQLFHLQKELAELREFTNHSLR
VSSFEKQIANPSTPSETKKPRSVAHLTGNPRSRSIPLEWEDTYGTALISGVKYKKGGLVI
NEAGLYFVYSKVYFRGQSCNSQPLSHKVYMRNFKYPGDLVLMEEKKLNYCTTGQIWAHSS
YLGAVFNLTVADHLYVNISQLSLINFEESKTFFGLYKL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcccgtgaattacccatgtccccagatctactgggtagacagcagtgccact
tctccttgggctcctccagggtcagttttttcttgtccatcctctgggcctagagggcca
ggacaaaggagaccaccgcctccaccaccacctccatcaccactaccaccgccttcccaa
ccacccccgctgcctccactaagccctctaaagaagaaggacaacatagagctgtggcta
ccggtgatatttttcatggtgctggtggctctggttggaatggggttaggaatgtatcaa
ctctttcatctacagaaggaactggcagaactccgtgagttcaccaaccacagccttaga
gtatcatcttttgaaaagcaaatagccaaccccagcacaccctctgaaaccaaaaagcca
aggagtgtggcccacttaacagggaacccccgctcaaggtccatccctctggaatgggaa
gacacatatggaactgctttgatctctggagtgaagtataagaaaggcggccttgtgatc
aatgaggctgggttgtacttcgtatattccaaagtatacttccggggtcagtcttgcaac
agccagcccctaagccacaaggtctatatgaggaactttaagtatcctggggatctggtg
ctaatggaggagaagaagttgaattactgcactactggccagatatgggcccacagcagc
tacctaggggcagtatttaatcttaccgttgctgaccatttatatgtcaacatatctcaa
ctctctctgatcaattttgaggaatctaagaccttttttggcttatataagctttaa

DBGET integrated database retrieval system