KEGG   Rattus norvegicus (rat): 25398
Entry
25398             CDS       T01003                                 

Gene name
Cacna1a
Definition
(RefSeq) voltage-dependent P/Q-type calcium channel subunit alpha-1A
  KO
K04344  voltage-dependent calcium channel P/Q type alpha-1A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04020  Calcium signaling pathway
rno04721  Synaptic vesicle cycle
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04742  Taste transduction
rno04930  Type II diabetes mellitus
rno05017  Spinocerebellar ataxia
rno05032  Morphine addiction
rno05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25398 (Cacna1a)
   04020 Calcium signaling pathway
    25398 (Cacna1a)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    25398 (Cacna1a)
   04727 GABAergic synapse
    25398 (Cacna1a)
   04725 Cholinergic synapse
    25398 (Cacna1a)
   04728 Dopaminergic synapse
    25398 (Cacna1a)
   04726 Serotonergic synapse
    25398 (Cacna1a)
   04730 Long-term depression
    25398 (Cacna1a)
   04723 Retrograde endocannabinoid signaling
    25398 (Cacna1a)
   04721 Synaptic vesicle cycle
    25398 (Cacna1a)
  09157 Sensory system
   04742 Taste transduction
    25398 (Cacna1a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    25398 (Cacna1a)
  09165 Substance dependence
   05032 Morphine addiction
    25398 (Cacna1a)
   05033 Nicotine addiction
    25398 (Cacna1a)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    25398 (Cacna1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25398 (Cacna1a)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   25398 (Cacna1a)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 25398
NCBI-ProteinID: NP_037050
RGD: 2244
Ensembl: ENSRNOG00000052707
UniProt: P54282 O70368
Position
19
AA seq 2368 aa
MARFGDEMPGRYGAGGGGSGPAAGVVVGAAGGRGAGGSRQGGQPGAQRMYKQSMAQRART
MALYNPIPVRQNCLTVNRSLFLFSEDNVVRKYAKKITEWPPFEYMILATIIANCIVLALE
QHLPDDDKTPMSERLDDTEPYFIGIFCFEAGIKIVALGFAFHKGSYLRNGWNVMDFVVVL
TGILATVGTEFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMIPLLQIGLLLFFAIL
IFAIIGLEFYMGKFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGI
TQFDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGV
LSGEFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAEEVILAEDETDVEQRHPFD
GALRRATLKKSKTDLLNPEEAEDQLADIASVGSPFARASIKSAKLENSTFFHKKERRMRF
YIRRMVKTQAFYWTVLSLVALNTLCVAIVHYNQPEWLSDFLYYAEFIFLGLFMSEMFIKM
YGLGTRPYFHSSFNCFDCGVIIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTKYWA
SLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFDEGTPPTNFDTFPAAI
MTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVDNLA
NAQELTKDEQEEEEAANQKLALQKAKEVAEVSPLSAANMSIAVKEQQKNQKPAKSVWEQR
TSEMRKQNLLASREALYGDAAERWPTTYARPLRPDVKTHLDRPLVVDPQENRNNNTNKSR
APEALRQTARPRESARDPDARRAWPSSPERAPGREGPYGRESEPQQREHAPPREHVPWDA
DPERAKAGDAPRRHTHRPVAEGEPRRHRARRRPGDEPDDRPERRPRPRDATRPARAADGE
GDDGERKRRHRHGPPAHDDRERRHRRRKESQGSGVPMSGPNLSTTRPIQQDLGRQDLPLA
EDLDNMKNNKLATGEPASPHDSLGHSGLPPSPAKIGNSTNPGPALATNPQNAASRRTPNN
PGNPSNPGPPKTPENSLIVTNPSSTQPNSAKTARKPEHMAVEIPPACPPLNHTVVQVNKN
ANPDPLPKKEEEKKEEEEADPGEDGPKPMPPYSSMFILSTTNPLRRLCHYILNLRYFEMC
ILMVIAMSSIALAAEDPVQPNAPRNNVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAYF
RDLWNILDFIVVSGALVAFAFTGNSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDC
VVNSLKNVFNILIVYMLFMFIFAVVAVQLFKGKFFHCTDESKEFERDCRGKYLLYEKNEV
KARDREWKKYDFHYDNVLWALLTLFTVSTGEGWPQVLKHSVDATFENQGPSPGYRMEMSI
FYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEEYSLEKNERACIDFAISAKPLTRHMP
QNKQSFQYRMWQFVVSPPFEYTIMAMIALNTIVLMMKFYGASVAYENALRVFNIVFTSLF
SLECVLKVMAFGILNYFRDAWNIFDFVTVLGSITDILVTEFGNNFINLSFLRLFRAARLI
KLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIGIDGEDEDSDED
EFQITEHNNFRTFFQALMLLFRSATGEAWHNIMLSCLSGKPCDKNSGIQKPECGNEFAYF
YFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEYVRVWAEYDPAACGRIHY
KDMYSLLRVISPPLGLGKKCPHRVACKRLLRMDLPVADDNTVHFNSTLMALIRTALDIKI
AKGGADKQQMDAELRKEMMAIWPNLSQKTLDLLVTPHKSTDLTVGKIYAAMMIMEYYRQS
KAKKLQAMREEQNRTPLMFQRMEPPSPTQEGGPSQNALPSTQLDPGGGLMAQESSMKESP
SWVTQRAQEMFQKTGTWSPERGPPIDMPNSQPNSQSVEMREMGTDGYSDSEHYLPMEGQT
RAASMPRLPAENQRRRGRPRGNNLSTISDTSPMKRSASVLGPKARRLDDYSLERVPPEEN
QRYHQRRRDRGHRTSERSLGRYTDVDTGLGTDLSMTTQSGDLPSKDRDQDRGRPKDRKHR
PHHHHHHHHHHPPAPDRERYAQERPDTGRARAREQRWSRSPSEGREHATHRQGSSSVSGS
PAPSTSGTSTPRRGRRQLPQTPCTPRPLVSYSPAPRRPAARRMAGPPAPPGGSPRGCRRA
PRWPAHAPEGPRPRGADYTEPDSPREPPGGAHEPAPRSPRTPRAAGCASPRHGRRLPNGY
YAGHGAPRPRTARRGAHDAYSESEDDWC
NT seq 7107 nt   +upstreamnt  +downstreamnt
atggcccgctttggagacgagatgccgggccgctacggcgcaggcggaggaggctcaggg
ccggccgccggggtggtcgtgggcgccgcgggcggccgaggagccgggggcagccggcag
ggcgggcagcccggagcgcagaggatgtacaagcagtcgatggcgcagagagcgcggacc
atggccctctacaaccccatccctgtccgccagaactgcctcacggtcaaccgctccctg
ttcctcttcagtgaagacaacgtggtgagaaaatacgccaaaaagatcacggaatggcct
cccttcgagtacatgatcctggccaccatcattgctaactgcatcgtcctggccctggag
cagcacctccctgatgatgacaagacacccatgtccgagcggctggatgacacagaaccc
tatttcattggcatcttctgttttgaggctggaattaagatcgtggctcttggctttgcc
ttccacaaaggctcctacctgaggaatggctggaacgtcatggactttgtcgtggtgcta
acaggcatcttggccactgtcgggacggagtttgatctacggacactgagggcggttcgt
gtgctgcggccactcaagctggtgtctggaatcccaagtttacaagtcgtcctgaagtca
atcatgaaggcgatgatccctctgctgcagatcggcctcctcctgttttttgcaatcctt
atttttgcaatcatagggttagaattttatatgggaaaatttcataccacctgctttgaa
gaggggacagacgacatccagggtgagtcgccagctccgtgtgggacagaggagcctgcc
cgcacctgccccaacgggaccaaatgtcagccgtactgggaagggcccaacaacggcatc
actcagttcgacaacatcctgtttgctgtgctcactgttttccagtgcatcaccatggaa
ggctggactgatctcctctacaatagcaacgatgcctcagggaacacttggaactggttg
tacttcatccccctcatcatcatcggctccttttttatgctgaaccttgtgctgggtgtg
ctgtctggggagtttgccaaagaaagggaacgtgtagagaaccgaagggcttttctgaag
ctcagaagacaacagcagattgaacgtgagctcaatggatacatggagtggatctcgaaa
gcagaagaggtgatcctcgcggaggacgagacagacgtggagcagaggcacccttttgat
ggagctcttcggagagctactctgaagaaaagcaagacggacctgctcaaccctgaggag
gcggaggaccagcttgctgacatcgcgtctgtggggtctcccttcgccagagccagcatc
aaaagtgccaagctggagaattcgacttttttccacaaaaaggagagaagaatgcgtttc
tacatccgccgcatggtcaaaactcaggccttctactggaccgtgctcagtctggtagcc
ctcaacacgctgtgcgtcgccattgtccactacaaccagcccgagtggctctccgacttc
ctctactatgcagaattcattttcttaggactctttatgtccgaaatgtttataaaaatg
tatgggctcgggacacggccttacttccactcttccttcaactgctttgactgtggggtc
atcatcgggagcatctttgaagtcatctgggccgtcatcaaaccgggtacatcctttgga
atcagcgtgttacgagctctcaggttactgcgtattttcaaagtcacaaagtactgggca
tctctcagaaacctggttgtctccctcctcaactccatgaaatccatcataagtctgctg
ttcctcctcttcctcttcattgtcgtctttgccctcttggggatgcagctgtttggtggc
cagtttaattttgacgaggggactcctcccaccaacttcgacacttttccagcagcaata
atgactgtgtttcagatcctgactggcgaggattggaatgaggtcatgtatgatgggatc
aagtctcaggggggcgtgcagggcggcatggtgttctccatctacttcatcgtcctcacc
ctcttcgggaactacaccctgctgaacgtgttcttggctatcgcggtggacaacctggcc
aacgcccaggaactcaccaaggatgaacaagaagaggaagaggcagccaatcagaaactg
gctctacagaaagccaaggaggtggcagaagtgagtcccctgtctgcagccaacatgtcc
atagctgtgaaggaacagcagaagaaccagaagcctgccaagtcggtgtgggagcagcgc
accagcgagatgcgcaagcagaacctgctggctagccgcgaggcgctgtacggggacgcg
gctgagcgctggcccaccacttacgcgcgcccgctgcggccggacgtgaagacgcacttg
gaccggccgctcgtggtggacccgcaggagaaccgtaacaacaacaccaacaagagccgt
gcgccagaagcgctgcgccaaaccgcgcggccccgcgagagcgcgcgcgaccccgacgcg
cggcgcgcctggcccagcagccctgagcgcgcccctggacgagagggcccgtatggccgc
gagagcgagccgcaacagcgcgagcacgcgccaccccgcgagcacgtaccctgggacgcg
gatcctgagcgcgccaaggccggggacgcgccccgccgccacacgcaccggcctgtggcc
gagggcgagcctcgtcgccaccgcgcgcgccgccggcccggggacgaaccggacgacaga
ccggagcgcaggccgcgtccccgcgacgccactaggccggcccgcgctgcagacggcgaa
ggcgatgatggggagcgcaagcggcgacaccgacacgggccgccggcccacgatgacagg
gagcgcagacaccggcgcagaaaagagagccagggctctggggtccccatgtctggtccc
aacctgtccaccaccaggccaatccagcaggatctgggccgccaggacctgccactggct
gaggacctggacaacatgaagaacaacaagttggccaccggggagcctgccagtccccac
gacagcctgggccacagtggccttccccctagccctgccaagatcgggaacagcaccaac
cctggtcccgccttggccaccaatccccagaatgctgccagccgcaggacgcccaacaac
ccgggcaacccgtccaaccccggcccccccaagactcccgagaacagccttatcgtcacc
aaccccagcagcacccagcccaactcagcaaagactgccaggaaacccgagcacatggcg
gtggagatccccccggcctgcccgcccctcaaccacactgtggtccaagtaaacaaaaac
gccaacccagacccactgccaaagaaagaggaagagaagaaggaggaagaggaggcagac
cccggggaggatggcccaaagcccatgccgccctacagctccatgttcatcctctccacc
accaacccccttcgccggctgtgccattacatcctgaacctgcgctacttcgagatgtgc
atcctcatggtcattgccatgagtagcatcgcgctggccgccgaggacccggtgcagccc
aacgcaccccgcaacaacgtgctgcgatattttgactatgttttcacaggagtgtttacc
tttgagatggtgatcaagatgatcgacctgggcctcgtcctgcatcagggggcctatttc
cgtgacctgtggaacattctggacttcatagtggtcagtggggccctggtggcctttgcc
ttcactggcaatagcaaaggaaaggacatcaacaccatcaagtccctccgagtcctccgg
gtgctacgacctctaaagaccatcaagcggctgcctaagttgaaggccgtatttgactgc
gtggtgaactcgctcaagaacgtcttcaacatcctcattgtctacatgctcttcatgttc
atcttcgccgtggtggccgtgcagctcttcaagggcaaattcttccactgcacggacgag
tccaaggagtttgagagagactgtcgaggcaaatacctcctttacgagaagaacgaggta
aaggcgcgggaccgcgagtggaagaaatacgacttccactacgacaacgtgctctgggcc
ctgctcacgctctttacggtgtccacgggagagggctggccacaggtcctcaagcactca
gtggatgccacttttgagaaccagggccccagccccgggtaccgcatggaaatgtccatc
ttctacgtggtctactttgtggtgtttcccttcttctttgtcaatatctttgtggccttg
atcatcatcaccttccaggagcagggagacaagatgatggaagaatacagcctagagaaa
aatgagagggcctgcatcgactttgccatcagtgccaagccgctgaccaggcacatgccc
cagaacaagcagagcttccagtatcgaatgtggcagttcgtggtgtccccaccctttgag
tacaccatcatggccatgatcgctctcaacaccatcgtgctaatgatgaagttctatgga
gcctctgtggcctatgaaaacgcccttcgagtgttcaacattgtcttcacctccctcttc
tctctcgaatgtgtgctcaaagtcatggcttttgggattctgaattatttccgcgatgcc
tggaacatcttcgactttgtgactgttctgggcagcatcacagacatcctcgtcaccgag
tttgggaataacttcatcaacctgagctttctccgcctcttccgtgctgcccgactcatc
aaactcctccgccagggttacaccatccgcattctcctctggactttcgtgcagtctttc
aaggccctaccttatgtctgtctgctgatcgccatgctcttcttcatctatgccatcatc
gggatgcaggtgtttggcaacatcggcattgatggggaagatgaggacagcgatgaggat
gagttccaaatcacggagcacaataacttccggaccttcttccaagctctcatgcttctc
ttccggagcgccacaggggaagcgtggcacaacatcatgctgtcctgcctcagcgggaag
ccatgcgacaagaactccgggatccaaaaaccagagtgtggcaacgagttcgcctatttt
tactttgtctcgttcatcttcctttgctcatttctgatgctgaatctctttgttgctgtc
atcatggacaacttcgagtacctcacccgagattcctccatcctgggcccccaccacctg
gatgagtacgtgcgtgtctgggcagagtatgaccctgctgcctgcggccgcattcactat
aaggacatgtacagtttattgcgagtaatatcgccccctctcggcttaggcaagaaatgt
cctcatagggttgcttgcaagaggctcttgcggatggacctacccgtagcggatgacaac
accgttcacttcaactccaccttgatggctctgatccgaaccgccctggatatcaaaatc
gcaaagggtggagctgacaagcagcaaatggacgcagagctccgcaaggaaatgatggcc
atttggcccaacctgtctcagaagaccttggatctgctggtcacacctcacaagtccacg
gacctgacagtgggtaagatctacgcagccatgatgatcatggagtactaccggcagagc
aaggccaagaagctgcaggccatgcgagaggagcagaaccggacaccactcatgttccag
cgcatggagcctccatcgccaacacaggagggaggacccagccaaaacgcccttccctcc
actcagctggaccccggaggaggcctgatggctcaagaaagcagcatgaaggagagcccg
tcctgggtgacccagcgggcacaggagatgttccagaagactggtacctggagcccagag
cgagggccacccatcgacatgcctaacagccagcccaactcccagtctgtggagatgaga
gaaatgggaactgatggctactcagacagcgaacactacctccccatggaaggacagacc
agggccgcctccatgccccgcctcccagcagagaaccagaggagaaggggccggccacgt
ggaaataacctcagtaccatctctgataccagccccatgaagcgctcagcctccgtgctg
ggacccaaagcccggcgactggatgactactcactagagcgggtaccacctgaggagaac
caaaggtaccaccaacgccgccgggaccgtggccaccgcacctctgagcgctctctgggc
cgatacactgatgtggacacaggcctggggacagatctgagcatgaccacccaatcgggt
gacctgccctccaaagatcgggaccaggaccggggccggcccaaggaccggaagcatcgg
ccacaccaccaccaccaccatcatcaccatcatcccccggccccggaccgggagcgctac
gcacaggagcggccggacaccggccgggcgcgggcccgggagcagcgctggtcccgctcg
cccagcgagggtcgggagcacgcgacacacagacagggcagtagttccgtcagtggaagc
ccagccccctctacgtccggcaccagcacgccgcggcgcggccgccgccagctcccccag
accccctgcaccccgcggccgcttgtgtcctactcgcccgctccgcgcaggcctgcggcg
cgcaggatggcgggtcccccagcgccccctggcggctcgccgcggggttgccgccgtgcg
ccgcgctggcctgcgcatgcgcctgagggcccgcggccgcgcggtgccgactacaccgag
cccgacagcccgcgcgagccgccagggggcgcgcatgagcccgcgccgcggtcgcccagg
actccgcgcgccgcgggctgcgcgtcaccgcgccacggccgcaggctgcccaatggttac
tacgcggggcacggcgcgccacggccgcgcacagcccgcaggggcgcgcacgacgcgtac
agcgagagcgaggacgactggtgctaa

KEGG   Rattus norvegicus (rat): 257648
Entry
257648            CDS       T01003                                 

Gene name
Cacna1b
Definition
(RefSeq) voltage-dependent N-type calcium channel subunit alpha-1B isoform 1
  KO
K04849  voltage-dependent calcium channel N type alpha-1B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04020  Calcium signaling pathway
rno04721  Synaptic vesicle cycle
rno04723  Retrograde endocannabinoid signaling
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04930  Type II diabetes mellitus
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05032  Morphine addiction
rno05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    257648 (Cacna1b)
   04020 Calcium signaling pathway
    257648 (Cacna1b)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    257648 (Cacna1b)
   04725 Cholinergic synapse
    257648 (Cacna1b)
   04728 Dopaminergic synapse
    257648 (Cacna1b)
   04726 Serotonergic synapse
    257648 (Cacna1b)
   04723 Retrograde endocannabinoid signaling
    257648 (Cacna1b)
   04721 Synaptic vesicle cycle
    257648 (Cacna1b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    257648 (Cacna1b)
   05020 Prion disease
    257648 (Cacna1b)
   05022 Pathways of neurodegeneration - multiple diseases
    257648 (Cacna1b)
  09165 Substance dependence
   05032 Morphine addiction
    257648 (Cacna1b)
   05033 Nicotine addiction
    257648 (Cacna1b)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    257648 (Cacna1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    257648 (Cacna1b)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   257648 (Cacna1b)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 257648
NCBI-ProteinID: NP_001182128
RGD: 628852
Ensembl: ENSRNOG00000004560
UniProt: E1AW38
Structure
PDB: 
4DEX

Position
3
AA seq 2354 aa
MVRFGDELGGRYGGTGGGERARGGGAGGAGGPGQGGLPPGQRVLYKQSIAQRARTMALYN
PIPVKQNCFTVNRSLFVFSEDNVVRKYAKRITEWPPFEYMILATIIANCIVLALEQHLPD
GDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFVFHKGSYLRNGWNVMDFVVVLTGILA
TAGTDFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMVPLLQIGLLLFFAILMFAII
GLEFYMGKFHKACFPNSTDAEPVGDFPCGKEAPARLCDSDTECREYWPGPNFGITNFDNI
LFAILTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNLVLGVLSGEFA
KERERVENRRAFLKLRRQQQIERELNGYLEWIFKAEEVMLAEEDKNAEEKSPLDAVLKRA
ATKKSRNDLIHAEEGEDRFVDLCAAGSPFARASLKSGKTESSSYFRRKEKMFRFLIRRMV
KAQSFYWVVLCVVALNTLCVAMVHYNQPQRLTTALYFAEFVFLGLFLTEMSLKMYGLGPR
SYFRSSFNCFDFGVIVGSIFEVVWAAIKPGTSFGISVLRALRLLRIFKVTKYWNSLRNLV
VSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFQDETPTTNFDTFPAAILTVFQI
LTGEDWNAVMYHGIESQGGVSKGMFSSFYFIVLTLFGNYTLLNVFLAIAVDNLANAQELT
KDEEEMEEAANQKLALQKAKEVAEVSPMSAANISIAAFVKQTRGTVSRSSSVSSVNSPQQ
NSAKARSVWEQRASQLRLQNLRASCEALYSEMDPEERLRYASTRHVRPDMKTHMDRPLVV
EPGRDGLRGPAGNKSKPEGTEATEGADPPRRHHRHRDRDKTSASTPAGGEQDRTDCPKAE
STETGAREERARPRRSHSKEAPGADTQVRCERSRRHHRRGSPEEATEREPRRHRAHRHAQ
DSSKEGKEGTAPVLVPKGERRARHRGPRTGPRETENSEEPTRRHRAKHKVPPTLEPPERE
VAEKESNVVEGDKETRNHQPKEPRCDLEAIAVTGVGSLHMLPSTCLQKVDEQPEDADNQR
NVTRMGSQPSDPSTTVHVPVTLTGPPGEATVVPSANTDLEGQAEGKKEAEADDVLRRGPR
PIVPYSSMFCLSPTNLLRRFCHYIVTMRYFEMVILVVIALSSIALAAEDPVRTDSFRNNA
LKYMDYIFTGVFTFEMVIKMIDLGLLLHPGAYFRDLWNILDFIVVSGALVAFAFSGSKGK
DINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVLNILIVYMLFMFIFAVIAVQ
LFKGKFFYCTDESKELERDCRGQYLDYEKEEVEAQPRQWKKYDFHYDNVLWALLTLFTVS
TGEGWPMVLKHSVDATYEEQGPSPGFRMELSIFYVVYFVVFPFFFVNIFVALIIITFQEQ
GDKVMSECSLEKNERACIDFAISAKPLTRYMPQNKQSFQYKTWTFVVSPPFEYFIMAMIA
LNTVVLMMKFYDAPYEYELMLKCLNIVFTSMFSLECILKIIAFGVLNYFRDAWNVFDFVT
VLGSITDILVTEIAETNNFINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYV
CLLIAMLFFIYAIIGMQVFGNIALDDGTSINRHNNFRTFLQALMLLFRSATGEAWHEIML
SCLGNRACDPHANASECGSDFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILG
PHHLDEFIRVWAEYDPAACGRISYNDMFEMLKHMSPPLGLGKKCPARVAYKRLVRMNMPI
SNEDMTVHFTSTLMALIRTALEIKLAPAGTKQHQCDAELRKEISSVWANLPQKTLDLLVP
PHKPDEMTVGKVYAALMIFDFYKQNKTTRDQTHQAPGGLSQMGPVSLFHPLKATLEQTQP
AVLRGARVFLRQKSATSLSNGGAIQTQESGIKESLSWGTQRTQDVLYEARAPLERGHSAE
IPVGQPGALAVDVQMQNMTLRGPDGEPQPGLESQGRAASMPRLAAETQPAPNASPMKRSI
STLAPRPHGTQLCNTVLDRPPPSQVSHHHHHRCHRRRDKKQRSLEKGPSLSVDTEGAPST
AAGSGLPHGEGSTGCRRERKQERGRSQERRQPSSSSSEKQRFYSCDRFGSREPPQPKPSL
SSHPISPTAALEPGPHPQGSGSVNGSPLMSTSGASTPGRGGRRQLPQTPLTPRPSITYKT
ANSSPVHFAEGQSGLPAFSPGRLSRGLSEHNALLQKEPLSQPLASGSRIGSDPYLGQRLD
SEASAHNLPEDTLTFEEAVATNSGRSSRTSYVSSLTSQSHPLRRVPNGYHCTLGLSTGVR
ARHSYHHPDQDHWC
NT seq 7065 nt   +upstreamnt  +downstreamnt
atggtccgcttcggggacgagctaggcggccgctatgggggcaccggcggcggggagcgg
gctcggggcggcggggccggcggggccggtggcccgggccaggggggtctgccgccgggc
cagcgggtcctgtacaagcagtccattgcgcaacgcgcacggaccatggccctgtacaac
cccatcccagtcaagcagaactgcttcaccgtcaaccgctcgctcttcgtcttcagcgag
gacaacgtcgtccgcaaatatgctaagcgcatcaccgaatggccgcccttcgaatatatg
atcctggccaccatcatcgccaactgtattgtcctggccctggagcagcacctccctgat
ggggacaagactcccatgtctgaacgactggatgacacggaaccttacttcatcggcatc
ttttgcttcgaggcgggcatcaagatcatagctctgggcttcgtgttccacaaaggctcc
tacctccggaatggctggaacgtcatggacttcgtggtggtcctcacagggattcttgcc
acagctggaactgactttgatctgcgcaccctgagggctgtgcgtgtgcttaggcccctg
aagttggtgtctggaattccaagcttgcaggtggtgctcaagtccatcatgaaggccatg
gtcccgctgctgcagatcgggctgctgctcttcttcgccatcctcatgttcgctatcatc
ggcctcgagttctatatgggcaaattccataaggcctgcttccccaacagcacagatgca
gagcctgtgggtgactttccttgtggcaaggaggcccctgctcgtctgtgtgacagtgac
accgaatgccgggagtactggccaggacccaactttggcatcaccaattttgacaacatc
ctgtttgccatcttgaccgtgttccagtgtatcaccatggagggctggactgacatcctc
tacaatacaaatgatgcggccggcaacacgtggaactggttgtacttcatccccctcatc
atcattggctccttcttcatgctcaacctggtgctcggtgtgctttcaggagagtttgcc
aaagagcgggagcgagtcgagaaccgccgtgccttcctgaagctccgcaggcagcagcag
attgagcgagaactgaatgggtacttggagtggatcttcaaggcggaggaagtcatgttg
gcagaggaggacaagaacgcagaagagaagtcccctttggatgcagtgttgaagagagct
gctaccaagaagagccgaaatgacctcatccatgcagaagagggggaggaccggtttgta
gacctctgtgctgctgggtctccctttgctcgtgccagcctcaagagtgggaagacagag
agctcatcgtacttccggaggaaggagaagatgttccggttccttatccgtcgtatggtg
aaagcacagagcttctactgggtggtactgtgcgtggtggccctgaacacgttgtgtgtg
gccatggtacactataatcagcctcagcggcttaccactgcactgtactttgcagagttt
gttttcctgggtctcttcctcacagagatgtccctgaagatgtacggtctagggcccaga
agctacttccggtcttccttcaactgctttgactttggggtgattgtggggagtatcttt
gaagtagtctgggctgccatcaagccaggaacctccttcggaatcagtgtgctgcgggct
ctccgactgctgaggattttcaaagtcaccaagtattggaactccctgaggaacctggtt
gtttccctcctcaactccatgaagtccatcatcagccttctcttcctgcttttccttttc
attgtggtcttcgctctgttggggatgcagctgtttgggggacagttcaactttcaagat
gagactccaaccaccaattttgataccttcccagctgccatcctcactgtgtttcagatt
ctgacaggagaggactggaatgcagtcatgtatcatgggattgagtcacaaggaggagtc
agcaaaggcatgttttcatccttttacttcatcgtcctgacactgtttggaaactacacc
ctgttgaacgttttcttggccattgctgtggacaaccttgccaatgcccaggagttgacc
aaggatgaagaggagatggaagaggcagccaatcagaagcttgctcttcagaaggccaaa
gaagtagctgaagtcagccccatgtctgctgccaacatctccattgctgcttttgtaaag
caaactcgaggtactgtatctcgcagctcatctgtctccagcgtaaactcaccgcagcag
aactcggccaaggcgcgctcagtatgggagcagcgggccagtcagctaaggctccagaac
ctgcgtgccagctgtgaggcactgtacagtgagatggacccggaggagcgcctgcgttat
gccagcacgcgccacgtgaggccagacatgaagacacacatggaccgacccctagtggtg
gaacctggtcgggatggcctgcggggacccgccgggaacaagtcaaagcctgagggcacg
gaggccaccgaaggtgcggatccaccacgccgacaccaccggcatcgtgatagggacaag
acctcagcctcaacccctgctggaggcgaacaggacaggacagactgcccaaaggccgaa
agcaccgagaccggggcccgggaggaacgtgcgcgccctcgtcgaagtcacagcaaggag
gctccaggggctgacacacaagtgcgttgtgagcgcagtagacgtcaccaccggcgcgga
tccccggaggaggccactgaacgggaacctcggcgccaccgtgcccaccggcacgcacag
gactcaagcaaggaaggcaaggagggcactgcaccggtgcttgtacccaagggcgagcgt
cgcgcaagacatcgaggcccgcgtacgggcccccgtgagacagagaacagtgaggagccc
acacgcaggcaccgtgcaaagcataaggtgccaccaacacttgagcccccagagagggag
gttgcagagaaggagagcaacgtggtggaaggggataaggaaactcgaaatcaccagccc
aaggaacctcgctgtgacctggaggccattgcggttacaggcgtgggctctctgcacatg
ctgcccagcacctgtctccagaaagtggacgaacagccagaggatgcagacaaccagcgt
aatgtcacccggatgggcagtcagccctcagaccccagcaccactgtgcatgtcccagtg
acactgacaggccctcccggggaggccactgtagttcccagtgctaacacggacctggaa
ggccaagcggagggcaagaaggaggcagaggctgacgatgtgctgagaagaggccccagg
cccatcgttccctacagttccatgttctgcctcagccccaccaacctactccgtcgcttc
tgccattacattgtgaccatgcggtactttgagatggtgattcttgtggtcatcgccttg
agcagcattgccctggctgctgaggatcccgtgcggaccgactcattccggaacaatgct
ctgaagtacatggactacatctttacaggagtcttcacctttgagatggtcataaagatg
atagacttgggcctgctgctgcaccctggggcctacttccgggacctgtggaacattctg
gacttcattgttgtcagtggagccctggtggcatttgcattctcaggatccaaagggaaa
gacatcaataccatcaagtctctgagagtcctgcgagtcctgcggcccctcaagaccatc
aagcggctgcctaaactcaaggctgtgtttgactgtgtggtgaactctctgaagaatgtc
ttgaacatcctgatcgtctacatgctcttcatgtttatatttgccgtcatcgccgtccaa
ctcttcaaagggaagttcttttactgcactgatgagtccaaggagctggagcgggactgc
aggggtcagtatttggattatgagaaggaagaggtagaagcccagccaaggcagtggaag
aaatatgacttccactatgacaatgtgctctgggccttgctgactctgtttacggtgtcc
acaggagaggggtggcccatggtgctgaaacactctgtggacgccacctatgaggagcag
gggccaagccccgggtttcggatggagctttccatcttctatgtggtctactttgtggtc
ttcccttttttctttgtcaacatctttgtggccttgatcatcatcaccttccaggagcag
ggggacaaggtgatgtctgagtgcagtctggaaaagaatgagagggcttgcattgacttt
gccatcagcgccaaacccctgacacggtacatgcctcagaacaagcagtcgttccagtat
aagacatggacatttgtggtctctccaccctttgagtacttcattatggccatgatagcc
ctcaacacagtggtgctgatgatgaagttctacgatgccccttatgagtacgagctgatg
ctgaagtgcttgaacatcgtcttcacatccatgttctctctggagtgcatcctgaagatc
atcgccttcggggtgttgaactacttcagagatgcctggaacgtctttgactttgtcact
gttttgggaagtattactgatattttagtaacggagattgcggaaacgaacaacttcatc
aacttgagcttccttcgcctcttccgggcagcacggctgatcaagctgcttcgccagggc
tacaccatccgcatcttgttatggacctttgtccagtcctttaaggcgctgccctacgtg
tgcctcctcattgccatgctgttcttcatctacgccatcatcggcatgcaggtttttgga
aacattgcccttgatgatggcaccagcatcaaccgacacaacaacttccggacatttctg
caagccttaatgctgttgttcaggagtgccactggggaggcctggcacgaaatcatgctg
tcttgcctgggcaaccgggcctgcgacccacatgccaacgccagcgaatgcgggagcgac
tttgcctatttttattttgtctccttcatcttcctctgttcctttctgatgctgaacctc
tttgttgctgtgatcatggacaatttcgaatacctcacgcgggattcttccatcctaggg
ccgcaccacctcgatgaattcattcgcgtctgggctgaatacgacccagctgcgtgtggg
cgcatcagttacaatgacatgtttgagatgctgaaacacatgtccccacctctgggtttg
gggaagaaatgcccggctcgagttgcatacaagcgcctggttcgaatgaacatgcccata
tccaatgaggacatgacggtacactttacatccacactgatggccctcatccggacggca
ctggagatcaagcttgccccagcggggacaaaacagcaccaatgtgatgctgagctgagg
aaggagatctcttctgtgtgggctaatctgccccagaagactctggacttactggtgcca
ccccacaaacctgacgagatgacagtggggaaggtctatgcggctctcatgatatttgac
ttctacaaacagaacaaaaccaccagagatcagactcaccaagctcctggaggcctgtcc
cagatgggtcctgtttccctgttccatcctctgaaggccaccctggagcagacacagccc
gctgtgctccgaggagctcgggttttccttcgacaaaagagtgcaacttccctcagcaat
gggggcgccatacaaacccaggaaagtggcatcaaggagtccctgtcctggggcacgcag
aggacccaggacgtactttatgaggccagagcacctctagaacgtggccattctgcagag
atccctgtggggcagccaggagcactggctgtagatgtccagatgcagaacatgacattg
agaggaccggatggggagccccagcctggcctggagagccaaggccgagcggcctctatg
ccacgcctggcggcagaaacacagccggcccctaatgccagccccatgaagcgctccatc
tccacactggctccacgcccgcatgggactcagctttgcaacacagtcctggaccggcca
cctcctagccaggtgtcccatcaccaccaccaccgctgccaccggcgcagggacaagaag
cagaggtccctggaaaaggggcccagcctgtctgttgacacagaaggtgcaccaagtact
gctgcaggatctggcctgccccatggagaagggtccacaggctgccggcgggagcgtaag
caagagcgaggccggtcccaggagcggaggcagccctcctcctcttcttcagagaagcag
cgcttctattcctgtgaccgctttgggagccgggagcccccacaacctaagccctccctc
agtagccaccccatatcgccaacagcggcactagagccaggaccccacccgcagggcagt
ggttccgttaatgggagccccttgatgtcaacatctggtgctagcacgccgggccgaggt
gggcggaggcagctcccccagactcccctgaccccacgccccagcatcacctacaagacg
gccaattcctcgcctgtccactttgctgagggtcagagtggccttccagccttctcccct
ggccgtctcagccgcggcctttctgaacacaatgccctgctccagaaagagcccctgagc
cagcctctagcttctggctcccgcattggctctgacccttacctagggcagcgtctggac
agtgaggcctctgcccacaacctgcctgaggatacactcacctttgaagaggccgtggcc
accaactctggccgctcctccaggacttcctatgtgtcctccctcacttcccaatcccac
cctctccgccgtgtacccaatggctaccactgcactttgggactcagcaccggcgtccgg
gcgcggcacagctaccaccacccagaccaggatcactggtgctag

DBGET integrated database retrieval system