KEGG   Rattus norvegicus (rat): 25402
Entry
25402             CDS       T01003                                 

Gene name
Casp3
Definition
(RefSeq) caspase-3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04010  MAPK signaling pathway
rno04115  p53 signaling pathway
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04650  Natural killer cell mediated cytotoxicity
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno04726  Serotonergic synapse
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05133  Pertussis
rno05134  Legionellosis
rno05145  Toxoplasmosis
rno05146  Amoebiasis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05210  Colorectal cancer
rno05222  Small cell lung cancer
rno05416  Viral myocarditis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25402 (Casp3)
   04668 TNF signaling pathway
    25402 (Casp3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    25402 (Casp3)
   04215 Apoptosis - multiple species
    25402 (Casp3)
   04115 p53 signaling pathway
    25402 (Casp3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    25402 (Casp3)
   04657 IL-17 signaling pathway
    25402 (Casp3)
  09156 Nervous system
   04726 Serotonergic synapse
    25402 (Casp3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25402 (Casp3)
   05206 MicroRNAs in cancer
    25402 (Casp3)
   05205 Proteoglycans in cancer
    25402 (Casp3)
   05203 Viral carcinogenesis
    25402 (Casp3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    25402 (Casp3)
   05222 Small cell lung cancer
    25402 (Casp3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    25402 (Casp3)
   05161 Hepatitis B
    25402 (Casp3)
   05160 Hepatitis C
    25402 (Casp3)
   05164 Influenza A
    25402 (Casp3)
   05162 Measles
    25402 (Casp3)
   05168 Herpes simplex virus 1 infection
    25402 (Casp3)
   05163 Human cytomegalovirus infection
    25402 (Casp3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    25402 (Casp3)
   05169 Epstein-Barr virus infection
    25402 (Casp3)
   05165 Human papillomavirus infection
    25402 (Casp3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    25402 (Casp3)
   05133 Pertussis
    25402 (Casp3)
   05134 Legionellosis
    25402 (Casp3)
   05152 Tuberculosis
    25402 (Casp3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    25402 (Casp3)
   05145 Toxoplasmosis
    25402 (Casp3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    25402 (Casp3)
   05012 Parkinson disease
    25402 (Casp3)
   05014 Amyotrophic lateral sclerosis
    25402 (Casp3)
   05016 Huntington disease
    25402 (Casp3)
   05020 Prion disease
    25402 (Casp3)
   05022 Pathways of neurodegeneration - multiple diseases
    25402 (Casp3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    25402 (Casp3)
   05416 Viral myocarditis
    25402 (Casp3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    25402 (Casp3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    25402 (Casp3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    25402 (Casp3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    25402 (Casp3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     25402 (Casp3)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C14: caspase family
   25402 (Casp3)
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 25402
NCBI-ProteinID: NP_037054
RGD: 2275
Ensembl: ENSRNOG00000010475
UniProt: P55213
Position
16
AA seq 277 aa
MDNNETSVDSKSINNFETKTIHGSKSMDSGIYLDSSYKMDYPEMGLCIIINNKNFHKSTG
MSARNGTDVDAANLRETFMALKYEVRNKNDLTREEIMELMDSVSKEDHSKRSSFVCVILS
HGDEGVIFGTNGPVDLKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDD
DMACQKIPVEADFLYAYSTAPGYYSWRNSRDGSWFIQSLCAMLKLYAHKLEFMHILTRVN
RKVATEFESFSLDATFHAKKQIPCIVSMLTKELYFYH
NT seq 834 nt   +upstreamnt  +downstreamnt
atggacaacaacgaaacctccgtggattcaaaatccattaataattttgaaacaaagact
atccatggaagcaagtcgatggactctggaatatatctggacagcagttacaaaatggat
taccctgaaatgggcttgtgtataataattaataataagaacttccataaaagcactgga
atgtcagctcgcaatggtaccgatgtcgatgcagctaacctcagagagacattcatggcc
ctgaaatacgaagtcaggaataaaaatgaccttactcgtgaagaaattatggaattgatg
gatagtgtttctaaggaagatcacagcaaaaggagcagttttgtgtgtgtgattctaagt
catggagatgaaggagtaatttttggaacgaacggacctgtggacctgaaaaaactaact
agtttcttcagaggcgactactgccggagtctgactggaaagccgaaactcttcatcatt
caggcctgccgaggtacagagctggactgcggtattgagacagacagtggaactgacgat
gatatggcatgccagaagataccagtggaggccgacttcctgtatgcttactctaccgca
cccggttactattcctggagaaattcaagggacgggtcatggttcatccagtcactttgc
gccatgctgaaactgtacgcgcacaagctggaattcatgcacatcctcactcgtgttaac
cggaaggtggccacggaatttgagtccttctccctggacgccactttccatgcaaagaaa
cagatcccgtgtattgtgtcaatgctcacaaaagaactgtacttttatcactaa

DBGET integrated database retrieval system