KEGG   Rattus norvegicus (rat): 25403Help
Entry
25403             CDS       T01003                                 

Gene name
Cast
Definition
(RefSeq) calpastatin
  KO
K04281  calpastatin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    25403 (Cast)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calpain_inhib
Motif
Other DBs
NCBI-GeneID: 25403
NCBI-ProteinID: NP_445747
RGD: 2278
Ensembl: ENSRNOG00000010286
UniProt: P27321 F1LPH1
Structure
PDB: 

Position
2q11
AA seq 713 aa AA seqDB search
MSRPGPKPAASSRPRRGAAASHTQEHVNEKNIGSSSKPAEKKGSDEVTASSAATGTSPRM
STTGAKAVKIESEKSQSSEPPVIHEKKPKGKPKEGSEPQTLPKHASDTGSKHAHKEKALS
RSNEQIVSEKSSESKTKFQDAPSADGESVAGGVTVATASDKVVVKKKEKKSLTPTLPMES
TLNKLSDKSGVNAALDDLIDTLGECEDTNKDDPPYTGPVVLDPMDSTYLEALGIKEGTIP
PEYRKLLEKNEAITGPLPDSPKPMGIDHAIDALSSDFTCSSPTGKQTEKEKSTGESSKAQ
SAGVTRSAVPPQEKKRKVEEEVMNDQALQALSDSLGTRQPDPQSHLRQAKQVKEAKAKEE
RQEKCGEDEDTVPAEYRLKPAKDKDGKPLLPEPEETSKCLSESELIGELSADFVQPTYQE
KPSMPAAKIKKGVVPDDAVETLARSLGTRKEDPEDEKSLVDKVKEKAKEEDHEKLGEKEE
TIPPDYRLEIVKDKDGKPLLPKEAEEQLPPLSDDFLLDALSQDFSSPANILSLGFEDAKL
SAAVSETVSQVPAPSNHTAAPPPGTERRDKELDDALDELSDSLGQRQPDPDENKPLDDKV
KEKIKAEHSEKLGERDDTIPPEYRHLLDNDGKDKPEKPLTKNTEKPGQDQDPIDALSEDL
DSCPPTTETSQNTTKEKGKKTSSSKASKNEEKTKDSSKKTEEVPKPKVDEDAT
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggcccggcccgaagcccgccgcctcttccaggccccggcgcggggcggcagct
agccacacccaggagcatgttaatgaaaagaatattggatcatcttctaaaccagcagaa
aagaaaggatctgatgaggtgacagcttcctctgctgccactggcacatctcccagaatg
agtaccacaggagctaaggctgtgaaaatagagtctgagaagtcacaatcaagtgagcca
cctgtgattcatgagaaaaagccaaaaggaaagccaaaggaagggtcagagccccaaact
cttcctaagcatgcatcagatacaggaagtaagcatgctcacaaagaaaaagcactttcc
agatcaaatgagcagatagtgtcagagaaatcatcagaatcaaagacaaaatttcaagat
gctccttctgctgatggagagagtgtggctggaggtgtgactgtggccactgcctcagac
aaggtggttgttaagaaaaaagagaagaaatcattaacacctactttacctatggagtcc
acactaaacaagctatctgacaagtcaggcgtgaatgctgctttggatgacctgatagac
accttaggtgaatgtgaagatactaacaaagatgatccaccatatactggaccagtagtt
ctggacccaatggattctacctaccttgaggcactgggtataaaagaagggactattcct
ccagagtataggaaacttctggagaaaaatgaagctatcacaggacctcttccagattct
cctaaacctatgggaatcgaccatgctatagatgccttgtcatctgatttcacctgtagc
tctccaactggaaagcaaactgagaaagagaagtctactggggaaagttcgaaagctcag
tctgcaggagtgaccagaagtgctgttcctccccaggagaagaaaaggaaagtagaagag
gaggtcatgaatgatcaagccctgcaggctctgtcagattcactgggcacccggcagcca
gaccctcagagccatcttaggcaagccaaacaagtcaaagaggcaaaagcaaaagaagaa
aggcaggagaaatgtggtgaagatgaggacacagtacctgctgagtacaggttaaaacca
gccaaggataaagatggaaaaccactattgccagaacctgaagaaacatctaagtgcctg
agtgagtcagagctgattggggagctttcagcagattttgtccaacctacatatcaagaa
aaaccatctatgccagctgcaaaaataaagaagggcgtagtgccagatgatgctgtagaa
accttggctagaagcctggggacaaggaaagaagatccagaagatgaaaaatctctggtg
gataaagtcaaggagaaagctaaagaagaagatcatgaaaaacttggtgaaaaagaagaa
acaattcctcctgattatcgactagaaatagtcaaggataaggatggaaaaccgctcctg
ccaaaagaagccgaggaacaacttccacccttaagcgatgacttccttcttgatgcattg
tctcaggacttctccagtcctgcaaacatattgtctcttggttttgaagatgccaaactt
tctgctgctgtttctgaaacagtttcccaggtgcctgctccaagcaaccacacagcagcc
ccaccgcctggcactgagaggagagacaaagaactcgatgatgccttggatgaactttct
gacagtcttggacaaagacagcctgatccagatgagaacaaaccactagatgataaagta
aaggaaaaaatcaaagcagagcatagcgagaaactgggagaaagagacgacaccatcccc
cctgaatataggcatctcctggataatgatgggaaggacaaaccagagaagccactgaca
aagaacacagagaagcctggtcaggaccaggaccccattgatgccctctcagaagacttg
gatagctgccccccaactacagagacttcacagaatacaacaaaggagaagggtaagaag
acttcaagttccaaagcatccaagaatgaagagaaaacaaaggattcctccaagaagaca
gaggaagtgcccaagccaaaggtggatgaagatgcaacataa

DBGET integrated database retrieval system