KEGG   Rattus norvegicus (rat): 25404
Entry
25404             CDS       T01003                                 

Gene name
Cav1
Definition
(RefSeq) caveolin-1 isoform alpha
  KO
K06278  caveolin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04510  Focal adhesion
rno05020  Prion disease
rno05100  Bacterial invasion of epithelial cells
rno05205  Proteoglycans in cancer
rno05416  Viral myocarditis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25404 (Cav1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25404 (Cav1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    25404 (Cav1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    25404 (Cav1)
  09164 Neurodegenerative disease
   05020 Prion disease
    25404 (Cav1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25404 (Cav1)
   05416 Viral myocarditis
    25404 (Cav1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25404 (Cav1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    25404 (Cav1)
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 25404
NCBI-ProteinID: NP_113744
RGD: 2280
Ensembl: ENSRNOG00000056836
UniProt: Q2IBC6 Q3MHT6
Position
4
AA seq 178 aa
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVNEKQVYDAHTKEIDLVNRDPKHLN
DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFA
ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI
NT seq 537 nt   +upstreamnt  +downstreamnt
atgtctgggggtaaatacgtagactccgagggacatctctacactgttcccatccgggaa
cagggcaacatctacaagcccaacaacaaggccatggcagacgaggtgaatgagaagcaa
gtgtacgacgcgcacaccaaggagattgatctggtcaaccgcgaccccaagcatctcaac
gacgacgtggtcaagattgactttgaagatgtgattgcggaaccagaagggacacacagt
ttcgacggcatctggaaggccagcttcaccaccttcactgtgacaaaatattggttttac
cgcttgctgtctaccatcttcggcatccctatggcgctcatctggggcatctactttgcc
atcctctctttcctgcacatctgggcagttgtaccgtgcatcaagagcttcctgattgag
attcagtgcatcagccgtgtctattccatctacgtccacaccttctgtgatccactcttt
gaagcgattggcaagatattcagcaatatccgcatcagcacgcagaaagagatatga

KEGG   Rattus norvegicus (rat): 29161
Entry
29161             CDS       T01003                                 

Gene name
Cav3
Definition
(RefSeq) caveolin-3
  KO
K12959  caveolin 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04510  Focal adhesion
rno05020  Prion disease
rno05100  Bacterial invasion of epithelial cells
rno05205  Proteoglycans in cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    29161 (Cav3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    29161 (Cav3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    29161 (Cav3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    29161 (Cav3)
  09164 Neurodegenerative disease
   05020 Prion disease
    29161 (Cav3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    29161 (Cav3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29161 (Cav3)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    29161 (Cav3)
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 29161
NCBI-ProteinID: NP_062028
RGD: 2281
Ensembl: ENSRNOG00000005798
UniProt: P51638
Position
4
AA seq 151 aa
MMTEEHTDLEARIIKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWRV
SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI
YSLCIRTFCNPLFAALGQVCSNIKVVLRREG
NT seq 456 nt   +upstreamnt  +downstreamnt
atgatgaccgaagagcacacagatctggaggcacggatcatcaaggacattcactgcaag
gagatagacttggtgaacagagaccccaagaacatcaatgaggacattgtgaaggtggat
tttgaagatgtgattgcggagcccgagggcacttacagcttcgatggcgtgtggagggtg
agctacaccactttcaccgtctccaagtactggtgctaccgcctgctgtctacactgctg
ggtgttccactggccctgctctggggattcctgtttgcctgtatctccttctgccacatc
tgggccgtggtgccctgcattaagagctacctgattgagatccagtgcatcagccacatc
tactcactgtgtatccgcaccttctgcaacccgctctttgccgcactgggccaggtctgc
agcaacattaaggtggtgctgcgaagggaaggctaa

KEGG   Rattus norvegicus (rat): 363425
Entry
363425            CDS       T01003                                 

Gene name
Cav2
Definition
(RefSeq) caveolin-2
  KO
K12958  caveolin 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04510  Focal adhesion
rno05020  Prion disease
rno05100  Bacterial invasion of epithelial cells
rno05205  Proteoglycans in cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    363425 (Cav2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    363425 (Cav2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    363425 (Cav2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    363425 (Cav2)
  09164 Neurodegenerative disease
   05020 Prion disease
    363425 (Cav2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    363425 (Cav2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    363425 (Cav2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    363425 (Cav2)
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 363425
NCBI-ProteinID: NP_571989
RGD: 620348
Ensembl: ENSRNOG00000057713
UniProt: Q2IBC5
Position
4
AA seq 162 aa
MGLETEKADVQLFMADDAYSHHSVVDYADPEKYVDSSQDRDPHQLNSHLKLGFEDLIAEP
PTTHSFDKVWICSHALFEISKYVIYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVK
TCLMVLPSVQTIWKSVTDVVIGPLCTSVGRIFSSVSMQLSHD
NT seq 489 nt   +upstreamnt  +downstreamnt
atggggctggagaccgagaaggccgacgtgcagctcttcatggccgatgacgcctacagc
caccacagtgtcgtcgactacgcagatcctgagaagtatgttgactccagtcaggaccgg
gatcctcaccagctcaactctcatctcaagctaggcttcgaggatctgatcgcagaacct
ccgactacacactcctttgacaaagtgtggatctgcagccacgcgctctttgaaatcagc
aaatacgtgatctacaagttcctgacggtgtttctagccatccccttggccttcattgcg
ggtatcctgtttgctaccctcagctgtctgcacatctggatcctaatgccttttgtgaag
acctgcctcatggtcctgccttccgtgcagacgatatggaagagtgtgacagatgttgtc
attggcccattgtgtacaagtgtagggcgcatcttctcctctgtcagcatgcaactgagc
catgactga

DBGET integrated database retrieval system