KEGG   Rattus norvegicus (rat): 25407
Entry
25407             CDS       T01003                                 

Gene name
Cd59
Definition
(RefSeq) CD59 glycoprotein precursor
  KO
K04008  CD59 antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    25407 (Cd59)
   04610 Complement and coagulation cascades
    25407 (Cd59)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25407 (Cd59)
   04090 CD molecules [BR:rno04090]
    25407 (Cd59)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    25407 (Cd59)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   25407 (Cd59)
  Exosomal proteins of other body fluids (saliva and urine)
   25407 (Cd59)
  Exosomal proteins of colorectal cancer cells
   25407 (Cd59)
CD molecules [BR:rno04090]
 Proteins
  25407 (Cd59)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  25407 (Cd59)
SSDB
Motif
Pfam: UPAR_LY6 Activin_recp
Other DBs
NCBI-GeneID: 25407
NCBI-ProteinID: NP_037057
RGD: 2311
Ensembl: ENSRNOG00000042821
UniProt: P27274
Position
3
AA seq 126 aa
MRARRGFILLLLLAVLCSTGVSLRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQ
CWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPNNGAISLLGKTALLVTSVLAA
ILKPCF
NT seq 381 nt   +upstreamnt  +downstreamnt
atgagagctcggaggggattcatcttactcctgcttctggctgtcctctgttccacaggt
gttagcctcagatgctacaactgtttagacccggtttcttcatgcaaaacaaacagcact
tgctctcctaacctggatgcttgtcttgttgctgtatccggaaagcaagtctatcaacag
tgttggagattttcggattgtaatgccaagttcattttgagccgactagaaatcgcaaac
gtacaatacagatgctgccaggcggacttgtgtaacaaaagcttcgaagacaagccaaac
aatggggcaatctccctattggggaagacagcgttgctggtgacctcggttctggcggcc
attttgaagccttgtttctaa

DBGET integrated database retrieval system