KEGG   Rattus norvegicus (rat): 25413Help
Entry
25413             CDS       T01003                                 

Gene name
Cpt2, CPTII
Definition
(RefSeq) carnitine palmitoyltransferase 2
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00071  Fatty acid degradation
rno01212  Fatty acid metabolism
rno03320  PPAR signaling pathway
rno04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    25413 (Cpt2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    25413 (Cpt2)
  09159 Environmental adaptation
   04714 Thermogenesis
    25413 (Cpt2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     25413 (Cpt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf Tri3
Motif
Other DBs
NCBI-GeneID: 25413
NCBI-ProteinID: NP_037062
RGD: 2398
Ensembl: ENSRNOG00000012443
UniProt: P18886
Structure
PDB: 

Position
5q34
AA seq 658 aa AA seqDB search
MMPRLLFRAWPRCPSLVLGAPSRPLSAVSGPDDYLQHSIVPTMHYQDSLPRLPIPKLEDT
MKRYLNAQKPLLDDSQFRRTEALCKNFETGVGKELHAHLLAQDKQNKHTSYISGPWFDMY
LTARDSIVLNFNPFMAFNPDPKSEYNDQLTRATNLTVSAVRFLKTLQAGLLEPEVFHLNP
SKSDTDAFKRLIRFVPPSLSWYGAYLVNAYPLDMSQYFRLFNSTRIPRPNRDELFTDTKA
RHLLVLRKGHFYVFDVLDQDGNIVNPLEIQAHLKYILSDSSPVPEFPVAYLTSENRDVWA
ELRQKLIFDGNEETLKKVDSAVFCLCLDDFPMKDLIHLSHTMLHGDGTNRWFDKSFNLIV
AEDGTAAVHFEHSWGDGVAVLRFFNEVFRDSTQTPAITPQSQPAATNSSASVETLSFNLS
GALKAGITAAKEKFDTTVKTLSIDSIQFQRGGKEFLKKKQLSPDAVAQLAFQMAFLRQYG
QTVATYESCSTAAFKHGRTETIRPASIFTKRCSEAFVRDPSKHSVGELQHMMAECSKYHG
QLTKEAAMGQGFDRHLYALRYLATARGLNLPELYLDPAYQQMNHNILSTSTLNSPAVSLG
GFAPVVPDGFGIAYAVHDDWIGCNVSSYSGRNAREFLHCVQKCLEDIFDALEGKAIKT
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgcgcctgctgtttcgtgcctggccccgctgcccctcgcttgtcctgggagcc
cctagtaggcccttaagtgctgtctcggggccggacgattatctgcagcacagcatcgtg
cccaccatgcactaccaggacagcctgcccaggctgcctatccctaaacttgaagacacc
atgaagagatacctcaatgcacagaagcctctcttggatgacagccagttcaggagaaca
gaagcgttgtgtaagaattttgagactggcgttgggaaggagctgcatgcccacctgctt
gctcaggataagcagaataagcacaccagctacatctcaggcccctggttcgatatgtat
ttaactgctcgagactctatcgttttaaactttaatccatttatggcattcaatccggac
ccaaagtctgagtataatgaccagcttaccagggcaaccaacttgactgtttctgcagtc
cggtttctgaagacacttcaggctggccttttagaaccagaagtgttccacttgaaccct
tccaaaagtgacacagacgccttcaaaagactcattcgctttgttcctccctctctgtcc
tggtatggagcctacctggtcaacgcatatcccctggatatgtcccagtatttccggctt
ttcaattcaactcgtatacccagacccaatcgtgatgaactctttactgacaccaaggct
agacacctcctggtcctaagaaaaggacatttctatgtctttgatgtcctcgatcaagat
gggaacattgtgaatcccttagagattcaggcacatctaaagtacattctctcagacagc
agccctgtgcccgagtttcctgtggcatatctgaccagtgagaaccgagatgtctgggca
gagctcagacagaagttgatttttgatggcaatgaggaaaccctgaagaaagtggactct
gctgtcttctgcctctgcctagatgacttcccgatgaaggatcttattcacttgtcacac
accatgctgcacggcgatggcacaaaccgctggtttgataagtcctttaacctcattgta
gccgaggacggcactgctgcagtccacttcgagcactcgtggggggatggggtggcagtg
cttaggtttttcaatgaagtgttcagagacagcactcagacccctgccatcactccccag
agccagcctgccgccaccaactcctctgcgtctgtggagacgctcagcttcaacctcagc
ggtgctctcaaggctggcatcactgctgccaaggagaagttcgacaccacggtgaaaacc
ctcagcattgactccattcagttccagagaggtggcaaggagttcctgaagaagaagcag
ctgagccccgatgcggtggcccagctggccttccagatggccttcctgagacagtatggc
cagacggtggctacctatgagtcctgcagcactgcagccttcaagcacggccgcacagag
actatccgcccagcctccatctttactaagagatgctccgaggcgtttgtcagggacccc
tccaagcacagtgtgggcgagcttcagcacatgatggctgagtgttccaaataccatggc
cagctgaccaaagaagcagcgatgggccagggctttgaccgacacttgtatgctctgcgc
tatctggcaacggccagaggactcaacctacctgagctctatctggatcctgcataccag
cagatgaaccacaacatcctgtccaccagcactctgaacagcccagcagtgagccttggg
ggctttgcccctgtggtccctgatggctttggcattgcatatgctgttcacgatgactgg
ataggctgcaatgtctcctcctactcaggacgcaatgcccgagagtttctccactgtgtc
cagaagtgcttggaagacattttcgatgctctagaaggcaaagccatcaaaacttag

DBGET integrated database retrieval system