KEGG   Rattus norvegicus (rat): 25417Help
Entry
25417             CDS       T01003                                 

Gene name
Dpysl4, Crmp3, Dpys4
Definition
(RefSeq) dihydropyrimidinase-like 4
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 Amidohydro_2
Motif
Other DBs
NCBI-GeneID: 25417
NCBI-ProteinID: NP_037065
RGD: 2409
Ensembl: ENSRNOG00000027582
UniProt: Q62951 F1LNT0
Position
1q41
AA seq 572 aa AA seqDB search
MSFQGKKSIPRITSDRLLIKGGKIVNDDQSFHADLYVEDGLIKQIGENLIVPGGIKTIDA
HGLMVLPGGVDVHTRLQMPVLGMTPADDFCQGTKAALAGGTTMILDHVFPDAGVSLLAAY
EQWRERADSAACCDYSLHVDIPRWHESTKEELEALVRDKGVNSFLVFMAYKDRCQCTDGQ
IYEIFSLIRDLGAVAQVHAENGDIVEEEQKRLLEQGITGPEGHVLSHPEEVEAEAVYRAV
TIAKQANCPLYITKVMSKGAADMVAQAKRRGVVVFGEPITASLGTDGSHYWSKNWAKAAA
FVTSPPINPDPTTADHLTSLLSSGDLQVTGSAHCTFTTAQKAVGKDNFTLIPEGINGIEE
RMSVVWEKCVASGKMDENEFVAVTSTNAAKIFNFYPRKGRVAVGSDADLVIWNPRATKVI
SAKSHNLNVEYNIFEGVECRGMPTVVISQGRVVLEDGNLLVTPGAGRFIPRKTFPDFVYK
RIKARNRLAEIHGVPRGLYDGPVHEVMLPAKPGSGTQARASCPGKISVPPVRNLHQSGFS
LSGSQADDHIARRTAQKIMAPPGGRSNITSLS
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtccttccaaggcaagaagagcattccccggataacgagtgaccgccttctcatcaaa
ggtgggaagattgtgaatgatgaccagtcctttcatgcggatctctacgtggaggacggt
ctgattaaacaaattggagaaaatcttatcgtccctgggggaatcaaaaccatcgatgct
catggtctgatggtactgcctgggggagttgacgtccacacccggctgcagatgcctgtg
ctgggcatgaccccagccgatgatttctgtcagggcaccaaggctgccctagcaggcggg
accacgatgatattggaccatgtgtttcctgatgctggcgtgagcctgctggcggcctat
gagcagtggcgggagcgagcagacagtgcagcctgctgtgactactccttacacgtggac
attccccgctggcatgagagcaccaaagaggagctggaggccctagtcagggacaaaggt
gtgaactccttcctggtcttcatggcttacaaggacaggtgccagtgtactgatggccag
atatatgaaatcttcagcctcatccgggacctgggagctgtggcccaggtgcatgcagaa
aacggggacatcgtggaggaggaacagaagcgcctgctggagcagggcatcactggtcct
gagggccatgtgctcagccacccagaagaggtagaggccgaagctgtgtacagagctgtg
accattgccaagcaggccaactgcccactgtatatcaccaaggtgatgagcaagggtgcg
gctgatatggttgcccaagccaagcgcaggggggtggtcgtctttggggaacctatcact
gccagcctgggcactgatggctcacactactggagcaagaactgggccaaggctgcagcc
ttcgtcacatcaccccctatcaacccggaccctactactgcagaccacctcacctctctg
ctgtccagtggggacctccaggtgacaggcagtgcacactgcaccttcactactgcccag
aaggctgttggcaaagataacttcacgctgatccccgagggcatcaacggtatagaagaa
cgcatgtctgtggtctgggagaaatgtgtggcttcagggaaaatggacgagaatgagttc
gttgccgtgaccagcacaaatgctgccaaaatcttcaatttctaccccaggaaggggcgt
gtggctgtgggctctgatgctgacctggtcatctggaaccccagggccacaaaagtcatc
tctgccaagagccataacctgaatgtagagtacaacatcttcgaaggagtggagtgcaga
ggcatgcccacggtggtcataagtcagggcagagtggtgctggaggacggaaacctgctt
gtcactccaggggctggccgcttcattccccggaagacattcccagactttgtctataag
aggataaaggctcgtaacaggctagcagagatccacggtgtgccccgaggcctgtatgat
gggcctgtccacgaagtgatgttacctgccaagccagggagcggcacacaagcccgtgca
tcctgtccaggcaagatctcagtgccacccgtgcgcaacctgcaccagtcagggttcagc
ctatctggctctcaggctgacgatcacattgccagacgcacagctcagaagatcatggca
ccccccggaggacgctccaacatcacttcactttcttag

DBGET integrated database retrieval system